Recombinant Arabidopsis thaliana Protein TIC 40, chloroplastic (TIC40)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana Protein TIC 40, chloroplastic (TIC40), also known as Protein TIC 40, chloroplastic, is a protein involved in protein precursor import into chloroplasts . TIC40 is a component of the motor complex that consists of a co-chaperone (TIC40) and a chaperone (HSP93) .

3.1. Identification and Localization

A cDNA clone encoding Arabidopsis Tic40, atTic40, was isolated and expressed in Escherichia coli, and the resulting proteins were used for antibody production . Antibodies were highly specific for Tic40 in both pea and Arabidopsis . In both pea and Arabidopsis, Tic40 is entirely associated with the inner membrane fraction .

3.2. Mutant Analysis

Arabidopsis mutants lacking functional atTic40 were isolated to investigate the role of Tic40 . The atTic40 gene is present as a single-copy gene located on chromosome V and contains 14 exons . Two T-DNA insertion mutants were isolated . The mutants had identical phenotypes except that the leaf shape of tic40-1 is long and slender instead of rounded like tic40-2 . The mutant embryos had normal morphology, but pale green coloration at later stages of embryo development . The tic40 mutant plants survived for 6–8 months, whereas wild-type plants died after 3 months . The chlorophyll content of mutant plants [0.37 mg chlorophyll/g fresh weight (FW)] was less than one-third that of wild-type plants (1.2 mg chlorophyll/g FW) throughout development .

3.3. Protein Interactions

Intact pea chloroplasts were reacted with dithiobis(succinimidylpropionate) (DSP) to cross-link proteins that were in close physical proximity . Total membranes were isolated and their proteins were solubilized with detergent followed by immunoprecipitation with anti-Tic40 antibodies . Tic40 was associated with Tic110 in intact chloroplasts . In addition, Toc75 and stromal Hsp93 were associated with the Tic40 immunoprecipitate . Association with Toc75 and Hsp93 provided further evidence that Tic40 was part of the translocon complex mediating chloroplast protein import .

3.4. Expression Studies

Overexpression of Tic40-His resulted in a massive proliferation of the IM (up to 19 layers in electron micrographs) without significant effects on plant growth or reproduction . Consistent with IM proliferation, the expression levels of other endogenous IM proteins (IEP37, PPT, Tic110) were significantly (10-fold) upregulated but those of outer envelope membrane (Toc159), stromal (hsp93, cpn60), or thylakoid (LHCP, OE23) proteins were not increased, suggesting retrograde signal transduction between chloroplast and nuclear genomes to increase lipid and protein components for accommodation of increased accumulation of Tic40 .

Role in Protein Import

Tic40 functions during translocation across the inner envelope membrane, at a similar stage to that of Tic110 and Hsp93 . The tic40 knockout mutants share several similarities with the tic20 antisense mutants, but also show important differences . Both groups of mutants are much paler and smaller and develop more slowly than wild-type plants . Chloroplasts isolated from these mutants were specifically defective in translocation across the inner envelope membrane . The non-lethal phenotype of tic40 mutants suggests that Tic40 plays an assisting role in protein import .

Data Table

FeatureDescription
Protein NameRecombinant Arabidopsis thaliana Protein TIC 40, chloroplastic (TIC40)
FunctionInvolved in protein precursor import into chloroplasts
LocationInner envelope membrane of chloroplasts
StructureContains a transmembrane domain near the N-terminus and a large hydrophilic domain in the stroma
Interaction PartnersTic110, Toc75, Hsp93
Mutant PhenotypePale green leaves, slow growth, reduced chlorophyll content
Overexpression PhenotypeMassive proliferation of the inner membrane
HomologyC-terminal end has sequence homology with co-chaperones Hop and Hip

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping is available upon prior arrangement and incurs an additional fee.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
TIC40; PDE120; At5g16620; MTG13.6; Protein TIC 40, chloroplastic; Protein PIGMENT DEFECTIVE EMBRYO 120; Translocon at the inner envelope membrane of chloroplasts 40; AtTIC40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
77-447
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIC40
Target Protein Sequence
SIFSSSRDQQTTSVASPSVPVPPPSSSTIGSPLFWIGVGVGLSALFSYVTSNLKKYAMQT AMKTMMNQMNTQNSQFNNSGFPSGSPFPFPFPPQTSPASSPFQSQSQSSGATVDVTATKV ETPPSTKPKPTPAKDIEVDKPSVVLEASKEKKEEKNYAFEDISPEETTKESPFSNYAEVS ETNSPKETRLFEDVLQNGAGPANGATASEVFQSLGGGKGGPGLSVEALEKMMEDPTVQKM VYPYLPEEMRNPETFKWMLKNPQYRQQLQDMLNNMSGSGEWDKRMTDTLKNFDLNSPEVK QQFNQIGLTPEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFN KISQLFPGMTG
Uniprot No.

Target Background

Function

TIC40, a chloroplastic protein in Arabidopsis thaliana, plays a crucial role in protein precursor import into chloroplasts. It is a component of a motor complex, collaborating with the co-chaperone TIC40 and the chaperone HSP93, which are associated with the TIC110 import channel. TIC40 facilitates the release of bound transit peptides from TIC110 and stimulates ATP hydrolysis by HSP93. Furthermore, it is involved in the reinsertion of proteins from the chloroplast stroma into the inner membrane.

Gene References Into Functions
  1. Tic40's functions extend beyond protein import; it influences subsequent processes involved in thylakoid biogenesis. PMID: 28684427
  2. The interaction between Tic40-NP and Hsp93 stimulates ATP hydrolysis by Hsp93; however, this hydrolysis is inhibited in Tic40-NP mutants N320A and N329A. PMID: 22888115
  3. This study describes the interaction of Tic110, Tic40, and Hsp93 in A. thaliana chloroplast protein transport. PMID: 15659100
  4. This research reports the interaction of Tic40 with rhomboid proteases using a yeast mitochondria-based assay. PMID: 17327256
  5. This publication analyzes the similarities between the chloroplast translocon component, Tic40, and the human co-chaperone, Hsp70-interacting protein. PMID: 17535810
  6. The sorting of AtTic40 requires a bipartite transit peptide, initially cleaved by stromal processing peptidase (SPP), generating a soluble AtTic40 stromal intermediate. PMID: 17883373
  7. In a Tic40 mutant, soluble Tic40 and Tic110N intermediates accumulated in the chloroplast stroma due to a slower rate of reinsertion into the inner membrane. PMID: 18657235
Database Links

KEGG: ath:AT5G16620

STRING: 3702.AT5G16620.1

UniGene: At.25049

Subcellular Location
Plastid, chloroplast inner membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in seedlings, flowers, leaves, stems and roots.

Q&A

What is the structural organization of Arabidopsis thaliana TIC40 protein?

TIC40 is an inner envelope membrane protein with a distinct structural organization featuring a single transmembrane domain near the N-terminus of the mature protein and a large hydrophilic domain located in the stroma . Immunological studies and tertiary structure prediction have revealed that the C-terminal portion contains a tetratricopeptide repeat (TPR) domain followed by a domain with sequence similarity to co-chaperones Sti1p/Hop and Hip . This structural arrangement is consistent with its proposed function as a co-chaperone within the chloroplast protein import machinery.

The mature protein contains approximately 11% proline, which causes TIC40 to migrate more slowly on SDS-PAGE than predicted based on its molecular mass . This high proline content is significant for researchers using protein electrophoresis techniques, as it results in apparent molecular weights that differ from theoretical calculations. When designing recombinant expression systems, researchers should account for this anomalous migration pattern during protein characterization.

How does TIC40 participate in the chloroplast protein import mechanism?

TIC40 functions as an integral component of the chloroplast translocon complex, specifically at the inner envelope membrane. It works in concert with other translocon components, including Tic110 and Hsp93 (ClpC), to facilitate protein translocation across the inner envelope membrane into the stroma . Cross-linking experiments have demonstrated that TIC40 physically associates with Tic110, Toc75, and stromal Hsp93 in intact chloroplasts, confirming its direct involvement in the translocon complex .

Mechanistically, TIC40 appears to function as a co-chaperone in the stromal chaperone complex . During protein import, TIC40 assists in the ATP-dependent translocation of precursor proteins across the inner membrane. Studies using tic40 mutant chloroplasts have shown that while precursor protein binding to the outer membrane remains normal, the subsequent translocation across the inner membrane is significantly impaired, with fewer precursors being translocated and more being released from the chloroplasts . This indicates that TIC40 plays a crucial role specifically during the translocation phase rather than the initial binding phase of protein import.

What experimental evidence supports TIC40's role in chloroplast protein import?

Several experimental approaches have provided strong evidence for TIC40's role in chloroplast protein import:

  • Protein import assays: Time-course experiments with isolated chloroplasts from tic40 mutants showed approximately 40% reduction in the initial rate of protein import compared to wild-type chloroplasts .

  • ATP-dependent translocation studies: Experiments manipulating ATP concentrations during import reactions demonstrated that while binding of precursor proteins occurred normally in tic40 mutants (at 0.1 mM ATP), subsequent translocation (at 5 mM ATP) was severely impaired .

  • Cross-linking studies: Chemical cross-linking using dithiobis(succinimidylpropionate) (DSP) followed by immunoprecipitation with anti-TIC40 antibodies revealed associations with other translocon components including Tic110, Toc75, and Hsp93, confirming TIC40's physical integration within the translocon complex .

  • Genetic analysis: Suppressor screens of tic40 mutants identified interactions with other chloroplast protein targeting pathways, particularly those involving the thylakoid protein targeting factors ALB4 and STIC2 .

These complementary experimental approaches collectively establish TIC40 as an essential component of the chloroplast protein import machinery, specifically functioning during the translocation phase across the inner envelope membrane.

What methods are most effective for producing recombinant TIC40 protein?

Production of functional recombinant TIC40 requires careful consideration of its structural features, particularly its transmembrane domain. Researchers have successfully expressed recombinant TIC40 by:

For studies requiring membrane-associated TIC40, reconstitution into liposomes or nanodiscs may provide a more native-like environment for functional analyses.

How can researchers effectively analyze TIC40 interactions with other translocon components?

Several complementary approaches have proven effective for studying TIC40 interactions:

  • In vivo cross-linking: Chemical cross-linkers like dithiobis(succinimidylpropionate) (DSP) can be used with intact chloroplasts to capture protein complexes in their native state. Following cross-linking, immunoprecipitation with anti-TIC40 antibodies can identify interacting partners .

  • Reciprocal immunoprecipitation: This approach provides confirmation of protein interactions. For example, Tic40 was successfully immunoprecipitated using anti-Toc75 antibodies, confirming their association .

  • Controls for specificity: Including non-interacting proteins as negative controls (e.g., chloroplast Hsc70, IEP21, or cpn60) is essential to validate the specificity of detected interactions .

  • Genetic interaction studies: Suppressor screens can identify genetic interactions that may reflect functional relationships. The identification of suppressor of tic40 (stic) mutants has provided insights into TIC40's relationship with thylakoid protein targeting pathways .

  • Co-localization studies: Immunolocalization using specific antibodies against TIC40 and other translocon components can provide spatial information about their associations within the chloroplast.

These methods, especially when used in combination, can provide robust evidence for physical and functional interactions between TIC40 and other components of the chloroplast protein transport machinery.

What approaches are used to study TIC40's response to environmental stresses?

TIC40 exhibits stress-responsiveness similar to other chaperones and co-chaperones. Researchers can investigate this aspect using several approaches:

  • Temperature stress treatments: Short-term heat shock (e.g., 4 hours at 37°C) and long-term cold acclimation (growth at 4°C) have been used effectively to study TIC40 responses .

  • Protein level analysis: Quantitative immunoblotting to measure TIC40 levels relative to other translocon components (such as Tic110) can reveal stress-induced changes in protein stoichiometry .

  • Transgenic approaches: Plants with modified TIC40 expression levels ("Low" and "High" lines) can be exposed to stress conditions to assess the relationship between TIC40 levels and stress tolerance .

  • Heat tolerance assessment: Heat tolerance can be evaluated by exposing seedlings to elevated temperatures (e.g., 37°C for 4-6 days) and monitoring for visible signs of damage including wilting, decoloration, necrosis, and death .

  • Statistical analysis: Statistical methods such as ANOVA should be employed to determine the significance of observed changes in TIC40 levels under different conditions .

These approaches can reveal how TIC40 participates in stress response pathways and potentially contributes to plant environmental adaptation mechanisms.

What are the key phenotypic characteristics of tic40 mutants?

Arabidopsis thaliana tic40 null mutants display distinctive phenotypes that provide insights into TIC40's physiological importance:

  • Growth and development: Mutant plants are very pale green and exhibit significantly slower growth than wild-type plants but are not seedling lethal . By 8 weeks, tic40 plants typically reach the developmental stage of 5-week-old wild-type plants, although they are significantly smaller, with a mass of about one-fifth that of comparable wild-type plants .

  • Chlorophyll content: The chlorophyll content in tic40 mutants is less than one-third that of wild-type plants (approximately 1.2 mg chlorophyll/g fresh weight) throughout development .

  • Chloroplast ultrastructure: Electron microscopy analysis has revealed that mutant chloroplasts have fewer granal stacks compared to wild-type chloroplasts .

  • Protein import efficiency: Chloroplasts isolated from tic40 mutants import precursor proteins at a lower rate (approximately 40% of wild-type rates), specifically showing defects in protein translocation across the inner envelope membrane .

  • Translocon component levels: Despite the import defects, other translocon components (Toc75, Toc159, Tic110, Tic22, and Hsp93) are present in tic40 chloroplasts at levels similar to or higher than in wild-type chloroplasts .

These phenotypic characteristics collectively indicate that while TIC40 is important for optimal chloroplast development and function, plants possess compensatory mechanisms that allow survival even in its absence.

How do suppressor mutations provide insights into TIC40 function?

Genetic suppressor screens have identified mutations that alleviate the phenotypic defects of tic40 mutants, providing valuable insights into TIC40's functional relationships:

  • STIC1/ALB4: The stic1 locus corresponds to the gene ALBINO4 (ALB4), which encodes a paralog of the thylakoid protein targeting factor ALB3 .

  • STIC2: This locus identified a previously unknown stromal protein that physically interacts with both ALB4 and ALB3 .

  • Functional pathway: Genetic studies revealed that ALB4 and STIC2 act together in a common pathway that also involves cpSRP54 and cpFtsY, components of the chloroplast signal recognition particle (cpSRP) pathway for thylakoid protein targeting .

The fact that mutations in thylakoid protein targeting components can suppress tic40 phenotypes suggests that TIC40 may have an additional role in the onward targeting of some thylakoid proteins . This potential dual function would be analogous to its proposed role in the post-import reinsertion of proteins into the inner envelope membrane.

These suppressor studies demonstrate the interconnected nature of different chloroplast protein transport pathways and suggest that the balance between these pathways is critical for optimal chloroplast development.

How does recombinant TIC40 respond to temperature changes in experimental systems?

Recombinant TIC40 exhibits temperature-responsive behaviors that provide insights into its potential functions in stress adaptation:

  • Temperature-dependent complex formation: Outside of a membranous context, the formation of complexes involving recombinant TIC40 can be influenced by temperature . This property may reflect TIC40's role in adapting protein import processes to changing environmental conditions.

  • Stress-responsive accumulation: TIC40 levels in plants increase significantly in response to both short-term heat shock and long-term cold acclimation . Specifically:

    • Plants subjected to heat shock (4 hours at 37°C) from both 21°C and 27°C growth temperatures showed statistically significant increases in TIC40 levels relative to Tic110

    • Plants grown at 4°C (cold acclimation) also exhibited increased TIC40:Tic110 ratios

  • Experimental quantification: The stoichiometric changes between TIC40 and Tic110 under different temperature conditions can be quantified and expressed as normalized ratios relative to wild-type samples (with wild-type ratios defined as 1) .

These temperature-responsive properties suggest that TIC40, like other chaperones and co-chaperones, participates in stress adaptation mechanisms by adjusting its abundance to accommodate changing protein transport requirements under different environmental conditions.

What is the relationship between TIC40 expression levels and plant stress tolerance?

Experimental manipulation of TIC40 expression levels has revealed correlations with stress tolerance:

  • Heat stress response: When exposed to heat stress (37°C for 4-6 days), transgenic Arabidopsis seedlings with different TIC40 expression levels showed varying degrees of heat tolerance :

    • "Low" lines (TIC40 levels suppressed approximately 3 times relative to wild-type) exhibited lower heat tolerance

    • "High" lines (TIC40 levels elevated about 6 to 10 times relative to wild-type) showed slightly higher heat tolerance

  • Quantitative assessment: In "Low" TIC40 lines, 258 out of 275 seedlings exhibited visible signs of heat damage, a significantly higher proportion than in wild-type or "High" TIC40 lines .

  • Normal growth conditions: All plant lines with altered TIC40 expression grew well under normal conditions with no visible signs of unhealthy phenotypes , indicating that TIC40 expression level manipulation primarily affects stress responses rather than normal development.

How can researchers distinguish between TIC40's roles in protein import versus thylakoid protein targeting?

Distinguishing between TIC40's dual roles requires sophisticated experimental approaches:

  • Protein-specific import assays: Using different precursor proteins targeted to various chloroplast compartments can help determine if specific targeting pathways are differentially affected in tic40 mutants .

  • Genetic interaction analysis: The suppression of tic40 phenotypes by mutations in thylakoid targeting components (e.g., ALB4, STIC2) suggests interactions between these pathways . Detailed analysis of double and triple mutants can help dissect these relationships.

  • Protein accumulation patterns: Comparing the accumulation of thylakoid proteins versus stromal proteins in tic40 mutants can indicate pathway-specific defects.

  • In vitro reconstitution: Developing in vitro systems that reconstitute specific steps of either the general import pathway or thylakoid targeting pathways with purified components including TIC40 would enable mechanistic studies of its differential functions.

  • Structure-function analysis: Creating TIC40 variants with mutations in specific domains and testing their ability to complement different aspects of the tic40 mutant phenotype could identify regions responsible for its distinct functions.

These approaches, particularly when used in combination, can help delineate TIC40's roles in general chloroplast protein import versus its potential specialized functions in thylakoid protein targeting.

What are the most promising approaches for identifying additional TIC40 interacting partners?

Future research to expand our understanding of TIC40's interactome could employ:

  • Proximity-based labeling: Techniques such as BioID or APEX2 fused to TIC40 could identify transient or weak interacting partners that might be missed by traditional co-immunoprecipitation approaches.

  • Cryo-electron microscopy: Structural studies of TIC40-containing complexes could provide insights into the spatial organization of the translocon complex and TIC40's position within it.

  • Split-reporter assays: Approaches such as split-GFP or split-luciferase complementation could validate protein-protein interactions in planta and potentially reveal the cellular contexts in which specific interactions occur.

  • Proteomics of isolated chloroplast envelope fractions: Comparing the protein composition of envelope fractions from wild-type versus tic40 mutant plants could identify proteins whose localization depends on TIC40.

  • Synthetic genetic array analysis: Systematic creation of double mutants combining tic40 with mutations in other chloroplast protein transport components could reveal functional relationships through genetic interactions.

These approaches would help create a more comprehensive understanding of TIC40's functional network within chloroplast protein transport pathways.

How might recombinant TIC40 be utilized to enhance plant stress resilience?

Based on the observed correlation between TIC40 levels and heat tolerance , several biotechnological applications could be explored:

  • Targeted overexpression: Expressing TIC40 under stress-inducible promoters could enhance plant resilience to specific environmental challenges while avoiding potential developmental effects of constitutive overexpression.

  • Crop improvement: Introducing optimized TIC40 variants into crop species might enhance their ability to maintain chloroplast function and photosynthetic efficiency under stress conditions.

  • Screening for enhanced variants: Directed evolution approaches could potentially generate TIC40 variants with improved chaperone or co-chaperone activities, potentially enhancing stress protection.

  • Combined engineering approaches: Co-expressing TIC40 with other stress-protective factors might produce synergistic effects on plant stress resilience.

  • Tissue-specific expression: Targeting TIC40 overexpression to tissues particularly vulnerable to stress damage could provide localized protection where most needed.

These applications would require careful optimization and validation in model systems before deployment in agricultural contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.