Recombinant Arabidopsis thaliana Protein TIC 55, chloroplastic (TIC55)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
TIC55; TIC55-II; At2g24820; F27C12.26; Protein TIC 55, chloroplastic; Translocon at the inner envelope membrane of chloroplasts 55; AtTIC55; Translocon at the inner envelope membrane of chloroplasts 55-II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
49-539
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIC55
Target Protein Sequence
RSAVAGTAVSDQTEGGGDVLLNPEEEKRVEVADYDWTEEWYPLYLTKNVPEDAPLGLTVY DRQIVLYKDGEGTLRCYEDRCPHRLAKLSEGQLIDGRLECLYHGWQFEGEGKCVKIPQLP ASAKIPKAACVKTYEVKDSQGVVWVWMSTKTPPNPEKLPWFENFARPGFFDISTTHELPY DHSILLENLMDPAHVPISHDRTDFTAKREDAQPLVFEVTERSNRGFAGTWGREKEGGKGS NLLRFDAPCVLQNNREFEGKDGVKNYFSGLFLCRPTGQGKSMLIVRFGVTKRSPLVSVLP QWFWHQNACKVFEQDMGFLSSQNEVLMKEKVPTKDLYLNLKSSDTWVAEYRKWMDKVGHG MPYHFGHRTISLPKVPPVVEHAPAGLIAALSASYPAKGGIGTMHAPNLANRYFRHIIHCR SCSNVIKSFELWKNILSATAVALTALAILVVSRQWKAVLLGSAALCSAAAYTCLRAINLN TNNFIRTHRRL
Uniprot No.

Target Background

Function
This protein is involved in the import of protein precursors into chloroplasts and is part of the redox regulon comprising TIC32, TIC55, and TIC62.
Gene References Into Functions
  1. Research indicates a direct role for dark-induced Tic55 protein in chlorophyll catabolism and an indirect role in the MYB108-NAC signaling pathway during leaf senescence. PMID: 29937503
Database Links

KEGG: ath:AT2G24820

STRING: 3702.AT2G24820.1

UniGene: At.22189

Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in green tissues and very low levels in non-photosynthetic tissues such as roots and etiolated seedlings.

Q&A

What is TIC55 and what is its primary function in Arabidopsis thaliana?

TIC55 is a chloroplast protein that is part of the translocon at the inner envelope membrane of chloroplasts (Tic complex). Despite its classification as a Tic protein member, TIC55 has been shown to be non-essential for functional protein import in Arabidopsis thaliana . Instead, TIC55's primary biological function appears to be related to dark-induced senescence . The protein contains a highly conserved CxxC domain (thioredoxin target region), which may function in chlorophyll metabolism controlled by light/dark cycles and redox reactions . TIC55 belongs to the LLS1-related non-heme family of proteins, which are typically involved in different stages of chlorophyll metabolism, suggesting an evolutionary relationship with proteins involved in chlorophyll degradation and biosynthesis .

How does TIC55 differ from other members of the chloroplast translocon complex?

Unlike other components of the Tic complex that are essential for protein import into chloroplasts, TIC55 is not vital for functional protein import in Arabidopsis thaliana . This significant functional divergence suggests that TIC55 has evolved specialized functions beyond the canonical role of Tic proteins. While most Tic proteins are directly involved in facilitating the translocation of nuclear-encoded proteins across the inner chloroplast membrane, TIC55 appears to have adopted a regulatory role in plant senescence processes . This functional specialization is consistent with the evolutionary pattern of translocon components, where certain members have acquired secondary functions beyond protein import.

What are the structural characteristics of TIC55 that contribute to its function?

TIC55 contains several important structural domains that contribute to its functionality. Most notably, it features a highly conserved CxxC domain, which functions as a thioredoxin target region . This domain is likely crucial for redox-regulated activities of the protein, particularly in response to light/dark transitions. TIC55 also shares structural similarities with other members of the LLS1-related non-heme family, such as pheophorbide a oxygenase (PAO) and chlorophyllide a oxygenase (CAO), which are involved in chlorophyll degradation and biosynthesis, respectively . These structural features likely enable TIC55 to participate in chlorophyll metabolism during senescence, explaining its role in dark-induced leaf aging processes.

What is the molecular mechanism by which TIC55 regulates dark-induced senescence?

TIC55 appears to regulate dark-induced senescence through control of senescence-associated gene expression networks. When leaves are subjected to dark treatment, TIC55 influences the expression of key senescence-related genes including PED1, BCB, SEN1, and RBCS2B . In the tic55-II knockout mutant, the expression of senescence-promoting genes (PED1, BCB, and SEN1) is inhibited at different stages of dark adaptation, while the expression of RBCS2B (typically downregulated during senescence) is elevated in early stages of dark response .

Microarray analysis has revealed that TIC55 affects the expression of numerous transcription factors involved in senescence regulation, particularly ANAC and WRKY family members . As shown in Table 1, multiple NAC domain-containing proteins (ANAC003, ANAC010, ANAC042, ANAC075) and WRKY transcription factors (AtWRKY31, AtWRKY55, AtWRKY72, AtWRKY75) show significantly decreased expression in the tic55-II knockout mutant .

How does TIC55 interact with transcription factor networks during senescence?

TIC55 interacts with at least three different transcription factor networks during senescence. Microarray analysis of the tic55-II knockout mutant has identified downregulation of multiple transcription factor families, including NAC domain proteins, WRKY proteins, and bHLH transcription factors . These transcription factors are key regulators in the senescence signaling network.

Particularly significant is the relationship between TIC55 and ANAC003, a senescence-related protein whose activation leads to expression of senescence-associated genes (SAGs) . Yeast one-hybrid assays have demonstrated that the ANAC003 promoter contains cis-acting elements that are responsible for binding different AtbHLH proteins, leading to transactivation of reporter genes . Based on combined evidence, a model has been proposed where three signaling pathways (involving MYB108, AtWRKYs, and AtbHLHs) control the expression of ANAC003, which then triggers senescence . TIC55 appears to function upstream of these transcription factor networks, coordinating their activity during dark-induced senescence.

What is the relationship between TIC55 and chlorophyll degradation during senescence?

TIC55's role in chlorophyll degradation during senescence is supported by several lines of evidence. First, TIC55 is structurally related to other LLS1-related non-heme family proteins that are directly involved in chlorophyll metabolism, such as pheophorbide a oxygenase (PAO) and chlorophyllide a oxygenase (CAO) . Second, experimental data from individually darkened leaves (IDLs) shows that tic55-II knockout mutants retain significantly more chlorophyll than wild-type plants after 5 days of dark treatment .

The molecular mechanism likely involves TIC55's regulation of senescence-associated genes that control chlorophyll catabolism. The CxxC domain in TIC55 suggests potential redox regulation of this process, possibly linking light/dark transitions to the initiation of chlorophyll breakdown during senescence . Additionally, TIC55 may influence chlorophyll degradation through its effects on the transcription factor networks that regulate this process, particularly through the ANAC003 pathway that has been implicated in controlling senescence-associated genes .

How does TIC55 function change under different stress conditions?

Interestingly, while TIC55 plays a significant role in dark-induced senescence, it appears to have limited impact on plant responses to various abiotic stresses. Experimental testing of the tic55-II knockout mutant under conditions of cold stress, heat stress, and high osmotic pressure did not reveal visible phenotypic differences compared to wild-type plants . This specificity of function suggests that TIC55 may be part of a specialized regulatory pathway that responds primarily to light/dark signals rather than general stress responses.

The lack of visible effects under these abiotic stress conditions contrasts with TIC55's clear role in dark-induced senescence, where significant molecular and physiological differences are observed between wild-type and knockout plants . This functional specificity may reflect the evolutionary history of TIC55 as it diverged from its original role in protein import toward specialized functions in chloroplast metabolism and senescence regulation.

What experimental systems are most suitable for studying TIC55 function?

The most well-established experimental system for studying TIC55 function is the Arabidopsis thaliana model, particularly using the tic55-II knockout mutant (SALK_086048) available from the Arabidopsis Biological Resource Center (ABRC) . This knockout line has been confirmed by genomic PCR and DNA sequencing to have a precise T-DNA insertion that eliminates TIC55 protein expression . Western blot analysis using TIC55-specific antibodies (αTIC55) has verified the complete absence of TIC55 protein in this mutant line .

For studying dark-induced senescence, the individually darkened leaves (IDLs) experimental approach has proven particularly effective . This method involves selectively darkening specific leaves (typically the expanding third and fourth rosette leaves) while maintaining normal light conditions for the rest of the plant . This approach allows for precise temporal control of senescence induction and facilitates comparative analysis between treated and untreated leaves within the same plant.

What molecular techniques are most valuable for analyzing TIC55's role in senescence?

Several molecular techniques have proven effective for analyzing TIC55's role in senescence:

  • Gene expression analysis: Semi-quantitative RT-PCR and microarray analysis have been successfully used to examine the expression of senescence-related genes (PED1, SEN1, BCB, RBCS2B) and transcription factors in wild-type and tic55-II knockout plants .

  • Chlorophyll quantification: Measuring chlorophyll retention during dark-induced senescence provides a quantitative physiological marker of senescence progression .

  • Yeast one-hybrid assays: This technique has been valuable for identifying transcription factors that bind to promoters of senescence-associated genes and may be regulated by TIC55 .

  • Western blotting: Using TIC55-specific antibodies to confirm protein absence in knockout lines is essential for validating experimental models .

  • Promoter analysis: Identification of cis-acting elements in promoters of senescence-associated genes helps elucidate the regulatory networks influenced by TIC55 .

How can researchers effectively design experiments to study TIC55's interaction with transcription factors?

To effectively study TIC55's interaction with transcription factors, researchers should consider a multi-faceted approach:

  • Comparative transcriptomics: Microarray or RNA-Seq analysis comparing wild-type and tic55-II knockout plants under normal and dark-induced senescence conditions can identify differentially expressed transcription factors . The data in Table 2 from the search results shows several transcription factors (including ANACs, WRKYs, and bHLHs) that are significantly downregulated in the tic55-II mutant .

  • Yeast one-hybrid assays: These can be used to test direct binding of candidate transcription factors to promoters of senescence-associated genes, as demonstrated with the ANAC003 promoter .

  • Chromatin immunoprecipitation (ChIP): This technique could identify direct binding sites of transcription factors affected by TIC55 across the genome.

  • Protein-protein interaction studies: Co-immunoprecipitation or yeast two-hybrid approaches could reveal whether TIC55 directly interacts with transcription factors or other regulatory proteins.

  • Transcription factor mutant analysis: Combining tic55-II mutations with mutations in identified transcription factors could help establish genetic hierarchies and regulatory relationships.

What considerations should be made when producing recombinant TIC55 protein for in vitro studies?

When producing recombinant TIC55 protein for in vitro studies, several important considerations should be addressed:

  • Expression system selection: Since TIC55 is a chloroplastic protein with redox-sensitive domains (CxxC) , expression systems that allow proper folding and disulfide bond formation may be crucial. Bacterial systems with specialized strains for disulfide bond formation or eukaryotic expression systems might be preferable.

  • Protein solubility: As a membrane-associated protein, TIC55 may have solubility issues. Optimization of buffer conditions or the use of detergents may be necessary to maintain protein solubility during purification.

  • Maintaining redox state: The CxxC domain in TIC55 suggests redox sensitivity . Purification conditions should control the redox environment to prevent unwanted oxidation or reduction of critical cysteine residues.

  • Functional assays: Development of in vitro assays to test TIC55 functionality, possibly related to its role in chlorophyll metabolism or interactions with thioredoxin systems, would be valuable for structure-function studies.

  • Post-translational modifications: If TIC55 undergoes post-translational modifications in vivo, expression systems that can reproduce these modifications may be necessary for obtaining functionally relevant recombinant protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.