The Sec61 beta subunit (UniProt ID: P38389) encoded by the At2g45070 gene in Arabidopsis thaliana is a 82-amino acid protein with a calculated molecular weight of 8.2 kDa . Its sequence (MVGSGAPQRGSAAATASMRRRKPTSGAGGGGASGGAAGSMLQFYTDDAPGLKISPNVVLIMSIGFIAFVAVLHVMGKLYFVK) includes transmembrane domains essential for ER membrane integration .
The Sec61 complex facilitates cotranslational translocation of nascent polypeptides into the ER and membrane insertion of transmembrane proteins . While the alpha subunit forms the channel, the beta subunit stabilizes the complex and modulates its activity . In Arabidopsis, this subunit is implicated in the unfolded protein response (UPR) under ER stress, with transcript levels increasing during tunicamycin or DTT treatment .
Recombinant At2g45070 is produced in E. coli as a His-tagged protein (N-terminal tag) . Key production parameters include:
| Parameter | Detail | Source |
|---|---|---|
| Expression System | E. coli | |
| Tag | His-tag (23 amino acids) | |
| Purity | >90% (SDS-PAGE verified) | |
| Storage | -20°C/-80°C in Tris/PBS buffer with 50% glycerol |
Mechanistic Studies: Used to dissect Sec61 translocon assembly and ER protein translocation in plants .
Stress Response Analysis: Monitored during UPR activation under ER stress agents (e.g., tunicamycin) .
Antibody Development: Recombinant protein serves as an antigen for generating monoclonal antibodies .
Transcriptional Regulation: At2g45070 expression increases 2.4–4.3-fold during ER stress, indicating its role in UPR .
Conservation: Shares 394 Blast hits across eukaryotes, highlighting evolutionary conservation of Sec61 function .
The Arabidopsis Sec61 beta subunit shares functional homology with human SEC61B, though sequence divergence exists:
Essential for protein translocation within the endoplasmic reticulum.
Arabidopsis thaliana Sec61 subunit beta (At2g45070) is a critical component of the Sec61 complex that forms both the endoplasmic reticulum (ER) translocon and retrotranslocon pores. The translocon facilitates protein translocation into the ER lumen during synthesis, while the retrotranslocon is involved in ER-associated protein degradation (ERAD), facilitating protein transport from the ER back to the cytosol for degradation . In plants, this protein plays essential roles in protein trafficking, quality control, and cellular homeostasis.
The Sec61 complex structure is highly conserved across eukaryotic species, from plants to mammals. Despite specific amino acid variations, the core structural elements and functional domains of Sec61β remain remarkably preserved. This conservation highlights the fundamental importance of this protein in cellular function. For example, both the barley HvSec61βa and Arabidopsis At2g45070 contain similar functional domains that enable their roles in the ER translocon and retrotranslocon systems . The high degree of conservation makes it possible to extrapolate some findings from mammalian or other plant Sec61β studies to understand the Arabidopsis protein's function.
For optimal expression of recombinant At2g45070 in E. coli, researchers should consider the following protocol:
Vector selection: Use pET-based expression vectors with strong promoters like T7.
E. coli strain: BL21(DE3) or Rosetta strains are recommended due to their reduced protease activity and enhanced expression of eukaryotic proteins.
Expression conditions:
Induce with 0.1-0.5 mM IPTG at OD600 = 0.6-0.8
Lower the temperature to 18-25°C post-induction
Express for 16-18 hours to maximize protein yield
Buffer optimization: Include 10% glycerol and 0.1% non-ionic detergent in purification buffers to maintain protein stability.
Since Sec61β is a membrane protein, specialized approaches may be needed to obtain properly folded protein, including the use of membrane-mimicking environments during purification.
Based on successful approaches with homologous proteins in other plants, the following cloning strategies are recommended for studying At2g45070 in planta:
For localization studies: Create C-terminal GFP fusion constructs using Gateway cloning. The coding sequence without stop codon can be amplified using primers with Gateway-compatible overhangs, similar to the approach used for barley Sec61βa . This allows visualization of the protein while minimizing disruption to its membrane insertion.
For gene silencing experiments: Develop RNAi constructs targeting specific regions of At2g45070. The coding sequence can be TOPO-cloned into a suitable entry vector (such as pENTR/D-TOPO) and then transferred to a plant expression vector using Gateway LR cloning . For Arabidopsis, vectors with the 35S promoter are commonly used to drive expression of the RNAi construct.
For complementation assays: The full-length coding sequence should be amplified and cloned under the control of either the native promoter or a constitutive promoter depending on the experimental goals.
A typical primer design strategy for amplifying At2g45070 would involve:
Forward primer including a CACC overhang for directional TOPO cloning
Reverse primer with or without a stop codon depending on whether a fusion protein is desired
The Arabidopsis Sec61β protein interacts with multiple partners as part of the Sec61 complex in the ER membrane:
In mammalian systems, the interaction between Sec61β and Sec62 is strongly enhanced when ribosomes are removed from the ER membrane, suggesting a ribosome-regulated mechanism of association . This interaction profile is likely conserved in the Arabidopsis system, with some plant-specific variations.
Based on studies in mammalian systems, the interaction between Sec61β and the SRP receptor (SR) plays a critical role in switching the translocon from Sec62-dependent to SRP-dependent translocation . This process likely operates similarly in Arabidopsis, where:
The SR binds to Sec61β, positioning the SRα subunit close to the translocon.
This binding displaces Sec62 from the translocon, as evidenced by the mutually exclusive crosslinking pattern observed between Sec61β and either SRα or Sec62 .
The charged linker region of SRα appears to be specifically responsible for displacing Sec62, facilitating the switch to SRP-dependent translocation.
This molecular switching mechanism ensures that proteins are properly targeted to the correct translocation pathway based on their signal sequences and translation status. In Arabidopsis, this pathway is likely essential for the proper folding and localization of secretory and membrane proteins.
Research on homologous proteins in other plants suggests At2g45070 plays a significant role in plant-pathogen interactions:
In barley, silencing of Sec61βa resulted in decreased susceptibility to powdery mildew fungus, suggesting that pathogens may exploit the Sec61 complex during infection .
The retrotranslocon function of Sec61β appears particularly important in this context, as it may provide a pathway for pathogen effector proteins to enter the plant cell cytosol .
During infection by biotrophic pathogens such as powdery mildew, the ER membrane containing Sec61 complex has been observed in close proximity to the extrahaustorial membrane (EHM) surrounding the pathogen's haustorium structure .
This spatial arrangement suggests that pathogens may actively recruit the host ER, including Sec61 complex, to facilitate effector protein transfer into the plant cell. In Arabidopsis, At2g45070 likely serves a similar function during interactions with compatible pathogens.
To investigate At2g45070's role in Arabidopsis pathogen defense, researchers can employ several strategic approaches:
RNAi-mediated silencing: Generate Arabidopsis lines with reduced At2g45070 expression using RNAi constructs targeting specific regions of the gene, then challenge these plants with various pathogens to assess altered susceptibility .
Co-localization studies: Create fluorescently tagged At2g45070 constructs (e.g., At2g45070-GFP) and co-express with ER lumen markers to visualize distribution during pathogen infection, particularly around haustorial structures .
Proximity labeling: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to At2g45070 during infection, potentially revealing pathogen effectors that interact with the Sec61 complex.
Domain swapping experiments: Replace domains of At2g45070 with corresponding regions from barley or other plant Sec61β proteins to identify regions critical for pathogen susceptibility.
Comparative transcriptomics: Compare expression profiles between wild-type and At2g45070-silenced plants during pathogen challenge to identify downstream defense pathways affected by Sec61β function.
The retrotranslocon function of At2g45070 is integral to ERAD in Arabidopsis through the following mechanisms:
As part of the Sec61 complex, it facilitates the retrotranslocation of misfolded or damaged proteins from the ER lumen back to the cytosol for proteasomal degradation.
The channel formed by the Sec61 complex provides a conduit through which ERAD substrates can pass through the ER membrane, a process that may require the structural flexibility provided by the β subunit.
In plant-pathogen interactions, this retrotranslocon function may be exploited by pathogens to deliver effector proteins into the host cytosol, bypassing normal cellular barriers .
Studies in other systems suggest that the Sec61 retrotranslocon works in concert with additional ERAD components, including E3 ubiquitin ligases, to identify and process ERAD substrates. Disruption of At2g45070 function would likely compromise ERAD efficiency, leading to ER stress and potentially activating the unfolded protein response (UPR).
Studying recombinant versus native At2g45070 requires distinct experimental considerations:
| Aspect | Recombinant At2g45070 | Native At2g45070 |
|---|---|---|
| Expression system | Bacterial (E. coli), yeast, or insect cells | Arabidopsis plant tissues |
| Protein yield | Higher yields possible | Limited by natural expression levels |
| Structural integrity | May lack post-translational modifications | Contains all native modifications |
| Functional analysis | In vitro reconstitution required | Can be studied in physiological context |
| Interaction studies | Pulldown assays with purified components | Co-immunoprecipitation from plant extracts |
| Localization | Requires in vitro membrane reconstitution | Can be visualized in planta with fluorescent tags |
For recombinant protein studies, researchers must carefully consider the appropriate expression system, as membrane proteins like Sec61β often require eukaryotic expression systems to maintain proper folding and insertion into membranes. For native protein studies, generating specific antibodies against At2g45070 can be challenging due to the high sequence conservation of Sec61β across species, potentially requiring the development of highly specific antibodies targeting variable regions of the protein.
While the Sec61β protein is highly conserved across species, the Arabidopsis At2g45070 exhibits several distinguishing structural features:
Transmembrane domain: The Arabidopsis Sec61β contains a single transmembrane domain that anchors it to the ER membrane, with slight variations in hydrophobicity and length compared to non-plant homologs.
N-terminal region: Plant-specific amino acid composition in the N-terminal cytosolic domain may reflect adaptation to plant-specific interacting partners.
Cysteine residues: Similar to the single endogenous cysteine in mammalian Sec61β that facilitates crosslinking studies , the Arabidopsis protein contains strategically positioned cysteine residues that may enable similar interaction studies.
C-terminal tail: The C-terminal region facing the ER lumen contains plant-specific residues that may be involved in interactions with plant-specific ER resident proteins.
These structural differences likely reflect evolutionary adaptations to the specific requirements of the plant secretory pathway and may influence how the protein interacts with both conserved Sec61 complex components and plant-specific factors.
Crystallizing recombinant At2g45070 presents several significant challenges:
Membrane protein solubility: As an integral membrane protein, At2g45070 requires detergents or membrane-mimicking environments to maintain solubility, which can interfere with crystal formation.
Small size and flexibility: The relatively small size of Sec61β (~10 kDa) and potential conformational flexibility make it difficult to obtain stable crystals.
Reconstitution complexity: Sec61β functions as part of a larger complex, and crystallization of the isolated subunit may not represent its physiologically relevant conformation.
Post-translational modifications: If At2g45070 undergoes plant-specific post-translational modifications, these would be absent in recombinant protein expressed in bacterial systems.
To overcome these challenges, researchers might consider:
Using lipidic cubic phase crystallization methods
Co-crystallizing with interacting partners like Sec61α
Employing cryo-electron microscopy instead of X-ray crystallography
Creating fusion constructs with proteins that facilitate crystallization
Alternatively, NMR spectroscopy might be more suitable for determining the structure of this relatively small membrane protein.
The expression of At2g45070 is dynamically regulated throughout plant development and in response to various stresses:
Developmental regulation: As a component of the essential protein translocation machinery, At2g45070 maintains baseline expression in all tissues, with elevated expression in actively secreting cells and developing tissues with high protein synthesis demands.
Stress responses: During ER stress, At2g45070 expression is upregulated as part of the unfolded protein response (UPR), which enhances the capacity for protein folding and quality control.
Pathogen challenge: Based on studies of the barley homolog, Sec61β expression may be modulated during pathogen infection, potentially as part of the plant's attempt to limit pathogen access to the host translocation machinery .
Tissue-specific expression: Certain specialized secretory tissues, such as nectaries or hydathodes, may show enhanced expression of At2g45070 to support their high secretory activity.
Regulatory elements in the At2g45070 promoter likely include binding sites for transcription factors involved in ER stress responses, such as bZIP60 and bZIP28, as well as developmental regulators specific to secretory tissues.
For monitoring At2g45070 expression under various experimental conditions, researchers can employ several complementary technologies:
| Technology | Application | Advantages | Limitations |
|---|---|---|---|
| RT-qPCR | Quantitative measurement of transcript levels | High sensitivity, specific quantification | Limited spatial information |
| RNA-Seq | Genome-wide expression analysis | Provides context within transcriptome | Requires bioinformatic expertise |
| Promoter-GUS/GFP fusions | Spatial expression patterns | Visualizes tissue-specific expression | May not capture post-transcriptional regulation |
| Western blotting | Protein level quantification | Directly measures protein abundance | Requires specific antibodies |
| Ribosome profiling | Translation efficiency analysis | Measures actively translated mRNA | Technically challenging |
| Single-cell RNA-Seq | Cell-type specific expression | Reveals cell-to-cell variation | Costly, requires specialized equipment |
For studying At2g45070 in pathogen response contexts, combining promoter-reporter fusions with confocal microscopy allows visualization of expression changes specifically around infection sites. Time-course experiments during pathogen infection or abiotic stress application can reveal the dynamics of At2g45070 regulation in response to environmental challenges.
CRISPR/Cas9-mediated complete knockout of At2g45070 in Arabidopsis likely results in severe phenotypes due to the essential nature of the Sec61 complex in protein translocation. Expected phenotypes include:
Embryo lethality: Complete loss of function may cause embryonic lethality due to disruption of essential protein translocation.
Conditional viability: Partial loss-of-function alleles may show:
Stunted growth due to compromised protein secretion
Chlorotic leaves from reduced chloroplast protein import
ER stress symptoms including upregulation of UPR marker genes
Defects in cell wall formation due to impaired secretion of cell wall components
Altered pathogen responses: Based on studies in barley, At2g45070 knockouts or knockdowns may show enhanced resistance to biotrophic pathogens like powdery mildew due to disruption of the pathogen's ability to deliver effector proteins .
Tissue-specific effects: Using tissue-specific CRISPR approaches may reveal variable requirements for At2g45070 function in different cell types, with secretory cells likely showing more pronounced defects.
Since complete knockout may be lethal, researchers often employ inducible knockout systems or targeted mutation of specific domains to understand protein function without completely eliminating it.
To create effective artificial miRNAs (amiRNAs) for studying partial loss-of-function of At2g45070:
Target site selection:
Choose sequences unique to At2g45070 with minimal off-target potential
Target the coding sequence rather than UTRs for more efficient knockdown
Avoid regions with high secondary structure that may impede miRNA binding
Consider targeting multiple sites for more effective silencing
Design parameters:
Follow established rules for amiRNA design (21-nt length, specific base pairing rules)
Ensure the amiRNA has appropriate thermodynamic properties (ΔG values)
Incorporate mismatches at positions 1 and 21 to mimic natural miRNA structure
Maintain perfect complementarity at positions 2-12 for effective targeting
Expression strategy:
Use inducible promoters (such as estrogen-inducible or dexamethasone-inducible) to control the timing and extent of silencing
Consider tissue-specific promoters to restrict silencing to tissues of interest
Employ a vector system that allows easy confirmation of amiRNA expression
Validation approaches:
Confirm target gene knockdown using RT-qPCR
Verify protein reduction by Western blot if antibodies are available
Perform parallel experiments with multiple independent amiRNA constructs to confirm phenotypes are due to At2g45070 silencing
This approach allows for tunable reduction in At2g45070 expression, which may bypass the lethality associated with complete knockout while still revealing gene function.
Understanding the role of At2g45070 in plant-pathogen interactions offers several promising avenues for engineering disease resistance in crops:
Targeted modification: CRISPR/Cas9 gene editing could be used to modify crop Sec61β proteins to reduce their exploitation by pathogens while maintaining essential cellular functions. Based on the barley study, even partial reduction of Sec61β function can enhance resistance to powdery mildew .
Pathogen interface disruption: Since the ER containing Sec61 appears to be recruited to pathogen haustoria , disrupting this interaction could limit pathogen access to the host translocation machinery without compromising plant viability.
Conditional expression systems: Developing crops with pathogen-induced silencing of Sec61β could provide a targeted defense response that activates only during infection, minimizing fitness costs.
Identification of resistance alleles: Screening crop germplasm for natural variants of Sec61β that maintain function while conferring pathogen resistance could identify valuable alleles for breeding programs.
Domain swapping: Creating chimeric Sec61β proteins that combine functional domains with regions resistant to pathogen manipulation could generate novel resistance mechanisms.
This research highlights how fundamental studies of protein translocation machinery can reveal unexpected roles in pathogen susceptibility, providing new targets for disease resistance engineering beyond traditional R-gene approaches.
To effectively model the role of Sec61 at plant-pathogen interfaces, researchers can employ several complementary experimental systems:
In planta pathosystems:
Arabidopsis-powdery mildew (Golovinomyces cichoracearum) provides a tractable model system with genetic resources
Barley-powdery mildew (Blumeria graminis f.sp. hordei) offers a well-characterized system where Sec61β involvement has been established
Transgenic plants expressing fluorescently tagged Sec61β can visualize dynamics during infection
Cellular models:
Isolated haustorial complexes with associated plant membranes for biochemical analysis
Split-GFP systems to detect proximity of pathogen effectors to Sec61 components
Protoplast-based assays for studying effector translocation mechanisms
Reconstituted systems:
Liposomes containing purified recombinant Sec61 complex components
Microfluidic devices mimicking the plant-pathogen interface membrane organization
Cell-free translation systems supplemented with Sec61-containing membranes
Advanced imaging platforms:
Super-resolution microscopy to visualize Sec61β localization at the haustorial interface
Correlative light and electron microscopy (CLEM) to combine functional and ultrastructural data
Live-cell imaging with photo-convertible fluorescent proteins to track Sec61β dynamics during infection