Recombinant Arabidopsis thaliana Protein TRIGALACTOSYLDIACYLGLYCEROL 2, chloroplastic (TGD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
TGD2; ABCI15; At3g20320; MQC12.6; Protein TRIGALACTOSYLDIACYLGLYCEROL 2, chloroplastic; ABC transporter I family member 15; ABC transporter ABCI.15; AtABCI15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-381
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TGD2
Target Protein Sequence
AASNSDAAHGQPSSDGGKNPLTVVLDVPRNIWRQTLKPLSDFGFGKRSIWEGGVGLFIVS GATLLALSWAWLRGFQMRSKFRKYQTVFELSHASGICTGTPVRIRGVTVGTIIRVNPSLK NIEAVAEIEDDKIIIPRNSLVEVNQSGLLMETMIDIMPRNPIPEPSVGPLHPECGKEGLI VCDRQTIKGVQGVSLDELVGIFTRIGREVEAIGVANTYSLAERAASVIEEARPLLKKIQA MAEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDLRKVNSSIMTPENTELIQKSIYTLVY TLKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL
Uniprot No.

Target Background

Function
This protein is a component of a chloroplast envelope phosphatidic acid/lipid transport complex. It specifically binds phosphatidic acid (PA) and is involved in lipid transfer from the endoplasmic reticulum (ER) to plastids. It is essential for thylakoid formation.
Gene References Into Functions
  1. TGD1, -2, and -3 proteins, involved in lipid trafficking, form an ATP-binding cassette (ABC) transporter complex with multiple substrate-binding proteins. PMID: 22544736
  2. TGD2 is part of a protein complex exceeding 500 kDa. The disruption of this complex in mutant alleles highlights its biological significance. PMID: 21309871
  3. The TGD2 (TRIGALACTOSYLDIACYLGLYCEROL 2) gene encodes the substrate-binding or regulatory component of a phosphatidic acid/lipid transport complex within the chloroplast inner envelope membrane. PMID: 16818883
  4. This protein is identical to the Arabidopsis gene TRIGALACTOSYLDIACYLGLYCEROL 2 (TGD2). PMID: 16818883
  5. TGD3 represents the missing ATPase component of a lipid transporter complex involving TGD1 and TGD2. This complex is crucial for the biosynthesis of ER-derived thylakoid lipids in Arabidopsis. PMID: 17938172
Database Links

KEGG: ath:AT3G20320

STRING: 3702.AT3G20320.1

UniGene: At.8172

Subcellular Location
Plastid, chloroplast inner membrane; Single-pass membrane protein.

Q&A

What are the optimal methods for detecting and analyzing TGD2 in plant samples?

MethodParametersApplicationNotes
Western Blot1:1000-1:2000 dilutionProtein detectionExpected MW: 42 kDa
Chloroplast isolationDifferential centrifugationComplex purificationIsolate intact envelope membranes
Native gel electrophoresisNon-denaturing conditionsComplex integrityPreserves >500 kDa complex
Recombinant expressionE. coli system, His-tagFunctional studiesExpress mature protein (aa 46-381)
Lipid binding assaysLabeled PASubstrate interactionMeasures binding affinity

For immunodetection, commercial antibodies against TGD2 are available and validated for Arabidopsis research . Store antibodies at -20°C for regular use and -70°C for long-term storage. Avoid repeated freeze-thaw cycles to maintain antibody function .

For characterizing protein-lipid interactions, liposome aggregation/fusion assays are valuable as TGD2 binding to PA has been demonstrated to stimulate membrane fusion events .

What phenotypes are observed in tgd2 mutants and what do they reveal about TGD2 function?

Disruption of TGD2 results in several distinctive phenotypes that highlight its essential role in lipid metabolism:

  • Lipid composition changes:

    • Reduced galactolipid levels in thylakoid membranes

    • Accumulation of unusual trigalactosyldiacylglycerol (TGDG) in leaves

    • Increased triacylglycerol (TAG) in vegetative tissues

    • Elevated phosphatidylcholine (PC) levels

    • ~2-fold increase in 18:1 and 18:2 fatty acids with corresponding decrease in 18:3

  • Developmental impacts:

    • Pale-green phenotype

    • Reduced growth compared to wild-type plants

    • Early flowering, potentially related to increased PC levels that interact with florigen FT

These phenotypes are analyzed through:

  • Thin-layer chromatography for detection of TGDG

  • Gas chromatography-mass spectrometry for fatty acid profiling

  • Comparative growth analysis with wild-type plants

The consistency of these phenotypes with other tgd mutants (tgd1, tgd3, tgd4, tgd5) confirms that these proteins function in the same lipid transport pathway connecting the ER and chloroplast .

How does TGD2 interact with other TGD proteins to form a functional transport complex?

TGD2 forms a large, stable complex with TGD1 and TGD3 in the inner envelope membrane of the chloroplast. This complex exhibits several remarkable features:

  • Unusual stoichiometry: The complex contains 8-12 copies of TGD2 (substrate-binding protein) per functional transporter, explaining its large size of >500 kDa

  • Domain architecture: TGD1 functions as the permease, TGD2 as the substrate-binding protein, and TGD3 as the ATPase component

  • Exceptional stability: The complex cannot be broken down by gentle denaturants to form a smaller "core" complex typical of standard ABC transporters

  • Multi-membrane system: While TGD1/2/3 localize to the inner envelope membrane, TGD4 forms a separate homodimer in the outer envelope membrane, raising questions about how lipids traverse the intermembrane space

  • Genetic interactions: TGD5 has been identified as another component in this pathway. Double mutants of tgd5 with tgd1-1 or tgd2-1 show synergistic embryo-lethal phenotypes, indicating complex functional relationships

The TGD complex represents a variation of the typical ABC transporter architecture, with the multiple copies of TGD2 possibly enhancing its lipid transport activity across the envelope membranes .

What is the significance of TGD2's phosphatidic acid binding capacity?

TGD2 specifically binds phosphatidic acid (PA), a property central to its function in lipid transport:

  • Selective substrate recognition: TGD2's binding specificity for PA suggests this is the lipid species transferred from the ER to chloroplasts

  • Membrane dynamics: PA binding to TGD2 stimulates liposome aggregation and membrane fusion, indicating TGD2 may facilitate formation of contact sites between membranes

  • Transport mechanism: The binding of PA is likely the initial step in a process where PA from the ER is captured by TGD2 and transported to the chloroplast for conversion to diacylglycerol (DAG)

  • Metabolic connectivity: PA is a central intermediate in lipid metabolism, serving as a precursor for both phospholipids and galactolipids, positioning TGD2 at a critical juncture between ER and chloroplast lipid synthesis pathways

This binding capacity can be studied using:

  • Lipid overlay assays with purified recombinant TGD2

  • Liposome-based assays with fluorescently labeled PA

  • Site-directed mutagenesis to identify residues essential for PA binding

How does TGD2 contribute to thylakoid membrane biogenesis and lipid composition?

TGD2 plays a critical role in thylakoid membrane formation through its function in the ER-to-chloroplast lipid transport pathway:

  • Galactolipid supply: TGD2 facilitates the transport of lipid precursors (PA) that are subsequently used for synthesis of monogalactosyldiacylglycerol (MGDG) and digalactosyldiacylglycerol (DGDG), which comprise approximately 75% of thylakoid membrane lipids

  • Eukaryotic pathway contribution: In Arabidopsis leaves, contributions from the eukaryotic (ER) and prokaryotic (chloroplast) pathways to chloroplast lipid synthesis are nearly equal. TGD2 is essential for the eukaryotic contribution, as evidenced by the distinctive fatty acid profiles at the sn-2 position (C18 vs. C16)

  • Membrane integrity: Proper thylakoid structure and function require specific lipid compositions, which are disrupted in tgd2 mutants

  • Developmental programming: The transition from proplastids to mature chloroplasts with developed thylakoids depends on appropriate lipid supply facilitated by TGD2

Methodological approaches to study this function include:

  • Electron microscopy of thylakoid ultrastructure in wild-type vs. tgd2 mutants

  • Lipidomic analysis of isolated thylakoid membranes

  • Time-course studies of chloroplast development in seedlings

  • Pulse-chase experiments with labeled lipid precursors

What are the proposed mechanisms of TGD2-mediated lipid transfer between envelope membranes?

Current research suggests a multi-step process for TGD-mediated lipid transport:

  • Initial lipid capture: PA is likely transported from the ER to the outer chloroplast envelope via an unknown mechanism, potentially involving membrane contact sites

  • TGD4-mediated outer envelope transport: TGD4, located in the outer envelope membrane as a homodimer, may capture PA and facilitate its movement to the intermembrane space

  • PA binding by TGD2: Multiple copies (8-12) of TGD2 in the TGD complex bind PA in the intermembrane space. This unusual stoichiometry may enhance efficiency of substrate capture

  • ABC transporter action: The TGD1/2/3 complex, functioning as an ABC transporter, uses ATP hydrolysis by TGD3 to power conformational changes that drive lipid transport across the inner envelope membrane

  • TGD5 involvement: TGD5 appears to play a role in this pathway, with genetic evidence showing interactions with other TGD components. TGD4 is epistatic to TGD5 in ER-to-plastid lipid trafficking

  • Subsequent metabolism: Once transported to the inner envelope, PA can be converted to DAG and used for galactolipid synthesis by MGDG synthase MGD1

This model represents an unusual variation of ABC transporter function specialized for lipid transport between different membrane systems within the cell.

What experimental approaches should be used to study TGD2 function in lipid metabolism and chloroplast development?

A comprehensive study of TGD2 function requires multiple complementary approaches:

Experimental ApproachApplicationKey Techniques/Considerations
Genetic manipulationGenerate loss/gain of functionCRISPR-Cas9, complementation with modified TGD2 variants
Protein-lipid interactionDetermine binding specificityLipid overlay assays, isothermal titration calorimetry
Subcellular localizationConfirm envelope localizationImmunogold EM, fluorescent protein fusions
Protein complex analysisCharacterize TGD complexBlue native PAGE, crosslinking mass spectrometry
Lipid transport assaysMeasure transport activityLiposome-based assays, labeled lipid tracing
Structural studiesDetermine 3D structureCryo-EM of purified complex
Developmental analysisAssess chloroplast biogenesisTime-course studies with inducible mutants

When designing genetic studies, recombinant inbred lines (RILs) of Arabidopsis thaliana can be particularly valuable, as they allow mapping of quantitative trait loci that interact with TGD2 in controlling lipid metabolism .

For protein expression, the mature form of TGD2 (amino acids 46-381) with an N-terminal His-tag has been successfully expressed in E. coli systems and retains functionality .

How is TGD2 function conserved across different plant species?

The evolutionary conservation of TGD2 across plant species reveals important insights about its fundamental role in chloroplast lipid metabolism:

  • Sequence conservation: The TGD2 protein structure appears to be conserved across diverse plant species including rice, Physcomitrella, Selaginella, and Klebsormidium, suggesting fundamental importance in plant lipid metabolism

  • Functional conservation: While the search results don't directly address functional conservation, the consistent presence of TGD-like proteins across plant lineages suggests the ER-to-chloroplast lipid transport mechanism is evolutionarily conserved

  • Structural predictions: Secondary structure predictions of TGD2 from various plant species consistently identify features resembling:

    • BCK1-like resistance to osmotic shock protein 1, V domain (Bro1V)

    • ESX-1 secretion-associated protein B (EspB)

    • Translocon at the inner chloroplast envelope membrane protein 110 (TIC110)

    • Legionella pneumophila effector protein C3 (LegC3)

  • Species-specific variations: Different plants vary in their reliance on the eukaryotic vs. prokaryotic pathways for chloroplast lipid synthesis. In Arabidopsis, the contributions are nearly equal, while other plants like pea (Pisum sativum) and maize (Zea mays) show different balances

Research investigating TGD2 across species can employ:

  • Comparative genomics and phylogenetic analysis

  • Complementation studies using TGD2 orthologs from different plant species

  • Structural modeling and comparative biochemistry of lipid binding domains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.