Recombinant Arabidopsis thaliana Protein WAX2 (WAX2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of WAX2

Protein Structure:

  • Sequence: Comprises 632 amino acids with a predicted molecular mass of 72.3 kD and a theoretical pI of 8.78 .

  • Domains:

    • Six transmembrane helices

    • N-terminal His-rich diiron-binding region (homologous to sterol desaturases)

    • C-terminal domain resembling short-chain dehydrogenase/reductase enzymes .

  • Expression System: Recombinant WAX2 is produced in E. coli with a purity >90% (verified by SDS-PAGE) and stored at -20°C or -80°C .

Gene Localization:

  • Encoded by the At5g57800 gene on chromosome 5, spanning 3,813 bp with 11 exons and 10 introns .

Functional Role in Cuticle Biosynthesis

WAX2 is integral to cuticle membrane formation and wax synthesis, as demonstrated by phenotypes of wax2 mutants:

ParameterWild Typewax2 Mutant
Cuticle Membrane Thickness111.2 nm151.7 nm (+36.4%)
Stem Wax Quantity11.9 mg/dm²9.5 mg/dm² (-20.2%)
Total Stem Wax Reduction78.3%
FertilityNormalReduced under low humidity

Key Mutant Phenotypes:

  • Postgenital organ fusion (e.g., flower buds)

  • Increased epidermal permeability

  • Altered stomatal index .

Recombinant Production and Applications

Research Applications:

  • Functional studies of cuticle membrane assembly

  • Enzymatic assays to characterize wax biosynthesis pathways

  • Protein interaction analyses (e.g., with CER1 homologs) .

Biochemical Insights from Mutant Studies

Wax Composition Alterations in wax2:

Wax ComponentWild Type (Stem)wax2 Mutant (Stem)
Aldehydes32.5%12.1%
Alkanes28.7%9.8%
Primary Alcohols15.2%24.6%
Esters8.4%18.9%

Metabolic Shifts:

  • Increased C30 primary alcohols suggest redirection of acyl-CoA precursors from alkane synthesis .

  • Loss of structural wax components (alkanes, aldehydes) correlates with cuticle fragility .

Implications for Plant Biotechnology

  • Agricultural Engineering: Modulating WAX2 expression could enhance drought tolerance by optimizing cuticle thickness and wax composition .

  • Developmental Biology: Links between cuticle integrity and stomatal index highlight WAX2’s role in coordinating epidermal architecture .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
CER3; FLP1; WAX2; YRE; At5g57800; MTI20.3; Very-long-chain aldehyde decarbonylase CER3; Protein ECERIFERUM 3; Protein FACELESS POLLEN 1; Protein WAX2; Protein YORE-YORE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CER3
Target Protein Sequence
MVAFLSAWPWENFGNLKYLLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHEL WSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSL PLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATL LENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMFDFMRCLGHCNVEIFSHKLFEILPVL RYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLGDTQNPNSWELQKKIRLSAGERKRVPEFV FLAHGVDVMSAMHAPFVFRSFASMPYTTRIFLLPMWPFTFCVMLGMWAWSKTFLFSFYTL RNNLCQTWGVPRFGFQYFLPFATKGINDQIEAAILRADKIGVKVISLAALNKNEALNGGG TLFVNKHPDLRVRVVHGNTLTAAVILYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRV LMLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHF HQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWK HHEVGAIDVDRIDLVWEAAMKYGLSAVSSLTN
Uniprot No.

Target Background

Function
WAX2 is involved in cuticule membrane and wax production, as well as typhine and sopropollenin biosynthesis in pollen. It is a core component of a very-long-chain alkane synthesis complex. WAX2 may be the fatty acid reductase responsible for aldehyde formation.
Gene References Into Functions
  1. CER1 interacts with both CER3 and CYTB5 to catalyze the redox-dependent synthesis of very-long-chain (VLC) alkanes from VLC acyl-CoAs. PMID: 22773744
Database Links

KEGG: ath:AT5G57800

STRING: 3702.AT5G57800.1

UniGene: At.7648

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in siliques, stems, flowers and weakly in leaves. Not detected in pollen, seeds and roots, but expressed in lateral root primordia. Specifically found in the L1 layer of the shoot apical meristem and in developing trichomes.

Q&A

What is the WAX2 gene in Arabidopsis thaliana and what is its significance?

The WAX2 gene (At5g57800) encodes a 632-amino acid integral membrane protein with a molecular mass of 72.3 kD and a theoretical pI of 8.78. It plays a critical role in both cuticle membrane formation and cuticular wax biosynthesis. WAX2 is significant because it represents one of the first characterized genes that affects both components of the plant cuticle system . The gene spans 3813 bp of genomic DNA and has 11 exons and 10 introns, with exons ranging from 51 to 257 bp and introns from 75 to 313 bp. The full-length cDNA is 2500 bp with a coding region of 1899 bp, a 376-bp 5′ untranslated region, and a 193-bp 3′ untranslated region .

What are the key structural features of the WAX2 protein?

WAX2 contains several distinct structural domains that provide insights into its function:

  • Six transmembrane domains that anchor it within the endoplasmic reticulum membrane

  • A histidine-rich diiron binding region at the N-terminal portion, homologous to members of the sterol desaturase family

  • A large soluble C-terminal domain that shares similarity with members of the short-chain dehydrogenase/reductase family

  • 32% sequence identity to CER1, another protein involved in wax production

These structural features suggest that WAX2 may function as a bifunctional enzyme with both desaturase and reductase activities involved in cuticle formation.

How does the wax2 mutant phenotype differ from wild-type Arabidopsis?

The wax2 mutant displays several distinctive phenotypes compared to wild-type Arabidopsis:

FeatureWild-typewax2 mutant
Cuticle membrane weight11.9 mg/dm²9.5 mg/dm² (20.2% less)
Cuticle membrane thickness111.2 nm151.7 nm (36.4% thicker)
Cuticle membrane appearanceOrganized, opaque structureLess opaque, structurally disorganized
Total wax on stemsNormal levelsReduced by 78.3%
Total wax on leavesNormal levelsReduced by 80.3%
Wax compositionNormal proportionsDeficiencies in aldehydes, alkanes, secondary alcohols, and ketones; increased acids, primary alcohols, and esters
Plant morphologyNormalPostgenital fusion between aerial organs (especially flower buds)
FertilityNormalReduced under low humidity
Epidermal permeabilityNormalIncreased
Stomatal indexNormalReduction on adaxial and abaxial leaf surfaces

Additionally, scanning electron microscopy shows the wax2 stem is severely reduced in epicuticular wax crystals compared to wild-type .

What methodologies are used to isolate and characterize WAX2 mutants?

Researchers employ several complementary approaches to isolate and characterize WAX2 mutants:

  • Insertional mutagenesis: T-DNA–mutagenized populations are screened for reduced visible glaucousness (waxiness) of the inflorescence stem. For instance, approximately 35,000 families from a T-DNA–mutagenized population of Arabidopsis ecotype C24 were screened to identify the original wax2 mutant .

  • Physiological assays: Mutants are further screened for changes in water loss rates from excised stems to identify those with altered cuticle properties.

  • Genetic analysis: Backcross F2 populations are analyzed for segregation ratios to confirm monogenic recessive inheritance patterns. For wax2, bialophos-resistant plants segregated in an approximate 3:1 ratio, indicating a single T-DNA insert .

  • Cosegregation analysis: Phenotypes such as glossy stem, small seedless siliques, and higher water loss rates are tracked to confirm genetic linkage.

  • Molecular verification: Gel blot analysis using specific gene probes verifies insert numbers and locations .

How does WAX2 function in cuticular wax and cuticle membrane biosynthesis?

WAX2 appears to function as a bifunctional enzyme involved in both wax synthesis and cuticle membrane formation:

  • The N-terminal region of WAX2 shows homology to sterol desaturases, suggesting a role in introducing double bonds into aliphatic chains

  • The C-terminal domain resembles short-chain dehydrogenases/reductases, indicating potential reductive activity

  • In wax2 mutants, the proportions of different wax components are altered, with reductions in aldehydes, alkanes, secondary alcohols, and ketones, suggesting that WAX2 is involved in the synthesis or modification of these components

  • The altered cuticle membrane structure in wax2 mutants indicates that WAX2 also plays a role in cuticle membrane formation, possibly through the synthesis or modification of cutin monomers

Based on these observations, researchers predict that WAX2 has metabolic functions associated with both aspects of cuticle production .

What experimental approaches can be used to elucidate the specific biochemical activities of WAX2?

To determine the precise biochemical activities of WAX2, researchers should consider:

  • In vitro enzyme assays: Express and purify recombinant WAX2 protein to test its activity on potential substrates, particularly those related to the biosynthesis of cutin monomers and wax components.

  • Substrate feeding experiments: Supply labeled precursors to wild-type and wax2 mutant plants to identify metabolic blocks and accumulation of intermediates.

  • Domain-specific mutations: Create targeted mutations in the desaturase and reductase domains separately to dissect their respective functions.

  • Complementation studies: Express chimeric proteins combining domains from related enzymes (e.g., CER1 and WAX2) to determine domain-specific functions .

  • Lipidomic analysis: Compare the full spectrum of lipid compounds between wild-type and wax2 mutants using advanced mass spectrometry techniques to identify all affected metabolites.

How can researchers investigate the relationship between WAX2 and other cuticle biosynthesis genes?

Several methodological approaches can help elucidate the relationship between WAX2 and other cuticle biosynthesis genes:

  • Double mutant analysis: Create double mutants between wax2 and other cuticle mutants (e.g., cer1, cer6) to identify epistatic relationships.

  • Transcriptome analysis: Compare gene expression profiles between wild-type and wax2 mutants to identify downstream effects on other biosynthetic genes.

  • Protein-protein interaction studies: Use yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation to detect physical interactions between WAX2 and other proteins in the pathway.

  • Subcellular co-localization: Determine whether WAX2 co-localizes with other cuticle biosynthesis enzymes using fluorescent protein fusions and confocal microscopy.

  • Conditional expression systems: Use inducible expression systems to manipulate WAX2 levels and observe immediate effects on other pathway components .

What are the challenges in expressing and purifying functional recombinant WAX2 protein?

Researchers face several challenges when working with recombinant WAX2:

  • Membrane protein solubilization: As an integral membrane protein with six transmembrane domains, WAX2 is difficult to extract from membranes and maintain in a soluble, active form.

  • Appropriate expression system selection: Bacterial expression systems often fail to properly fold complex eukaryotic membrane proteins, necessitating the use of yeast, insect, or plant cell-based expression systems.

  • Potential toxicity: Overexpression of membrane proteins can disrupt host cell membrane integrity, limiting expression levels.

  • Post-translational modifications: Plant-specific modifications may be required for WAX2 function but might be absent in heterologous systems.

  • Reconstitution requirements: The protein may require specific lipids or cofactors for proper folding and activity that must be included during purification and subsequent assays.

How can transcriptional regulation of WAX2 be investigated in different developmental contexts?

To study WAX2 transcriptional regulation across development:

  • Promoter analysis: Generate transgenic plants with WAX2 promoter:reporter gene fusions to visualize spatial and temporal expression patterns.

  • Chromatin immunoprecipitation (ChIP): Identify transcription factors that bind to the WAX2 promoter in different tissues and developmental stages.

  • Transcriptome profiling: Use RNA-seq to compare WAX2 expression across tissues, developmental stages, and in response to environmental cues.

  • Epigenetic analysis: Investigate DNA methylation and histone modifications at the WAX2 locus to understand epigenetic regulation.

  • Hormone response assays: Test WAX2 expression in response to different plant hormones to identify potential regulatory pathways.

  • Transcription factor mutants: Analyze WAX2 expression in plants with mutations in known transcription factors such as DEWAX, which has been identified as a negative regulator of cuticular wax biosynthesis genes .

What strategies can be employed to study the evolution of WAX2 function across plant species?

To study WAX2 evolution across plant species, researchers could:

  • Comparative genomics: Identify WAX2 homologs across plant species using bioinformatic approaches and analyze sequence conservation, especially in functional domains.

  • Heterologous complementation: Express WAX2 homologs from different species in the Arabidopsis wax2 mutant to test functional conservation.

  • Domain swapping: Create chimeric proteins with domains from WAX2 homologs across species to identify functionally conserved regions.

  • Structural modeling: Use protein structure prediction to compare the predicted structures of WAX2 homologs and identify conserved structural features.

  • Expression pattern comparison: Compare the expression patterns of WAX2 homologs across species to identify conserved regulatory mechanisms.

  • Biochemical activity comparison: Express and purify WAX2 homologs from different species to compare their enzymatic activities and substrate preferences.

What phenotyping techniques are most effective for characterizing wax2 mutants?

Several specialized techniques are essential for comprehensive phenotyping of wax2 mutants:

  • Transmission electron microscopy (TEM): Critical for visualizing cuticle membrane ultrastructure. TEM revealed that wax2 cuticle membranes are 36.4% thicker, less opaque, and structurally disorganized compared to wild-type .

  • Scanning electron microscopy (SEM): Essential for examining epicuticular wax crystal morphology and distribution. SEM showed that the wax2 stem was severely reduced in epicuticular wax crystals .

  • Gas chromatography-mass spectrometry (GC-MS): The gold standard for quantitative and qualitative analysis of cuticular wax composition. This technique revealed that wax2 has proportional deficiencies in aldehydes, alkanes, secondary alcohols, and ketones, with increased acids, primary alcohols, and esters .

  • Cuticle membrane isolation: Enzymatic or chemical (ZnCl₂) extraction methods to isolate intact cuticle membranes for weighing and further analysis. This showed that wax2 cuticle membranes weighed 20.2% less than wild-type despite being thicker .

  • Water loss assays: Measuring water loss rates from excised organs to assess cuticular permeability. This was key to identifying wax2 as having higher water-loss rates than other wax mutants .

  • Stomatal index calculations: Counting stomatal density relative to epidermal cells to quantify the reduction in stomatal index observed in wax2 mutants .

How can researchers design experiments to distinguish between direct and indirect effects of WAX2 on plant development?

To differentiate between direct and indirect effects of WAX2:

  • Tissue-specific complementation: Restore WAX2 expression in specific tissues of the wax2 mutant to determine where WAX2 function is required for different phenotypes.

  • Inducible expression systems: Use chemically inducible promoters to control the timing of WAX2 expression, allowing researchers to determine which phenotypes are immediately rescued versus those requiring long-term expression.

  • Developmental time course analyses: Compare the progression of morphological, cellular, and molecular phenotypes in wild-type and wax2 mutants to establish cause-and-effect relationships.

  • Grafting experiments: Graft wax2 scions onto wild-type rootstocks and vice versa to determine whether WAX2 functions cell-autonomously or if mobile signals are involved.

  • Single-cell transcriptomics: Compare gene expression at the single-cell level between wild-type and wax2 mutants to identify cell-specific responses to WAX2 dysfunction.

What are the key considerations for designing CRISPR/Cas9 gene editing experiments targeting WAX2?

When designing CRISPR/Cas9 experiments for WAX2:

  • Target site selection: Choose target sites in conserved functional domains, such as the His-rich diiron binding region or transmembrane domains, to create loss-of-function alleles.

  • Multiple guide RNAs: Design multiple guide RNAs targeting different regions of WAX2 to increase the likelihood of successful editing and to create a range of alleles.

  • Off-target analysis: Carefully analyze potential off-target sites, particularly in related genes like CER1 that share 32% identity with WAX2 .

  • Homology-directed repair templates: Design repair templates for precise gene editing, such as introducing specific point mutations or adding reporter tags.

  • Phenotypic screening strategy: Develop a rapid screening method, such as fluorescence-based detection of altered cuticular permeability, to identify edited plants.

  • Verification methods: Plan for comprehensive verification of edits using sequencing, protein expression analysis, and detailed phenotyping.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.