Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 2 (ALIS2)

Shipped with Ice Packs
In Stock

Description

Introduction to ALIS2

ALIS2 belongs to the Cdc50-like protein family that serves as β-subunits for P4-ATPases in Arabidopsis thaliana. These P4-ATPases, also known as phospholipid flippases, are believed to catalyze the flipping of phospholipids across cellular membranes, contributing significantly to vesicle biogenesis in both secretory and endocytic pathways. The formation of heteromeric complexes between P4-ATPases and Cdc50-like proteins such as ALIS2 is integral to this process, with these β-subunits playing a crucial role in the P4-ATPase transport machinery . Arabidopsis thaliana, with its relatively small genome size of approximately 135 Mb, serves as an excellent model organism for studying these plant-specific protein interactions . The production of recombinant ALIS2 has enabled researchers to investigate its structural properties and functional characteristics more thoroughly, providing insights into membrane dynamics in plant cells.

Historical Context and Discovery

The identification of ALIS2 emerged from broader studies of membrane transport mechanisms in plants. Research into phospholipid flippases revealed the importance of P4-ATPases in maintaining membrane asymmetry and facilitating vesicular transport. The discovery that these ATPases require binding partners for proper functioning led to the identification of several ALA-interacting subunits, including ALIS2. While the search results don't provide the exact discovery timeline, this protein has become recognized as a critical component in understanding plant membrane biology.

Classification and Nomenclature

ALIS2 is classified among the Cdc50-like proteins that function as β-subunits for P4-ATPases. The nomenclature "ALA-interacting subunit 2" directly reflects its functional relationship with ALA (Aminophospholipid ATPase) proteins in Arabidopsis thaliana. This naming convention emphasizes the protein's role as an interacting partner rather than a standalone functional unit. The "Putative" designation in its full name indicates that while substantial evidence supports its proposed function, some aspects of its activity may still require additional experimental validation.

Protein Structure

The recombinant production of ALIS2 has provided opportunities to study its structural characteristics more precisely. Like other Cdc50-like proteins, ALIS2 likely features multiple membrane-spanning regions that integrate it into cellular membranes. These transmembrane domains play a crucial role in positioning the protein to interact effectively with its ALA partners. The extracellular portions of the protein may also contribute to recognition and binding of specific phospholipid substrates, though detailed structural analyses would be needed to confirm this hypothesis.

Molecular Properties

As a β-subunit protein, ALIS2 likely exhibits specific molecular properties that facilitate its interaction with ALA proteins. These properties would include appropriate surface charges and hydrophobic regions that enable stable binding to the catalytic α-subunit. The recombinant production of ALIS2 allows for detailed biochemical characterization, including determination of molecular weight, isoelectric point, and binding affinities for various ALA proteins.

Role in Phospholipid Transport

The primary function of ALIS2 appears to be supporting P4-ATPase activity in phospholipid translocation. P4-ATPases are responsible for flipping specific phospholipids from the outer to the inner leaflet of cellular membranes, a process critical for establishing and maintaining membrane asymmetry. ALIS2, as a β-subunit, likely facilitates this activity through direct interaction with ALA proteins, though the exact mechanism by which it enhances flippase activity remains an area of active investigation.

Involvement in Cellular Processes

Beyond its direct role in phospholipid transport, ALIS2 likely contributes to various cellular processes that depend on membrane dynamics. By supporting phospholipid flipping, ALIS2 indirectly influences vesicle formation, membrane curvature, and potentially signal transduction pathways that rely on specific membrane compositions. Similar to the AP2 complex that plays an essential role in clathrin-mediated endocytosis in Arabidopsis , ALIS2-containing complexes may participate in specific membrane trafficking pathways, though this would require further experimental validation.

Interaction with ALA Proteins and P4-ATPases

The name "ALA-interacting subunit 2" directly reflects ALIS2's primary function: interaction with ALA proteins (P4-ATPases) in Arabidopsis. This interaction forms the basis for functional phospholipid flippase complexes. From the search results, we can infer that P4-ATPases form heteromeric complexes with Cdc50-like proteins such as ALIS2, and these complexes are necessary for phospholipid translocation across membranes .

Binding Mechanisms

The binding between ALIS2 and ALA proteins likely involves specific recognition domains on both proteins. These interactions must be sufficiently stable to maintain functional complexes while potentially allowing for regulation through association and dissociation. Research on P4-ATPases has demonstrated that cellular targeting and lipid specificity require the α-subunit (ALA protein) but may be independent of the β-subunit (such as ALIS2) . This suggests that while ALIS2 is necessary for proper functioning of the complex, the specificity determinants reside primarily with the ALA protein.

Functional Significance of Interaction

The formation of complexes between ALIS2 and ALA proteins has significant functional implications. Research indicates that while the ALA α-subunit determines lipid specificity and cellular targeting, the interaction with β-subunits like ALIS2 may be essential for proper trafficking, stability, or activation of the complex . The production of recombinant ALIS2 has facilitated investigations into these interactions, allowing researchers to study complex formation in controlled experimental settings.

Methods of Recombinant ALIS2 Production

The production of recombinant ALIS2 involves expressing the protein in laboratory systems to obtain sufficient quantities for experimental analysis. While the search results don't provide specific methods for ALIS2 production, the recombinant expression of membrane proteins typically employs established molecular biology techniques.

Expression Systems

Recombinant ALIS2 production likely utilizes expression systems suitable for membrane proteins. These could include bacterial systems like Escherichia coli, yeast systems such as Pichia pastoris, insect cell systems using baculovirus, or plant-based expression systems. Each system offers different advantages in terms of protein folding, post-translational modifications, and yield. For a plant membrane protein like ALIS2, systems that provide appropriate membrane insertion machinery would be particularly valuable.

Purification and Characterization

After expression, recombinant ALIS2 would typically undergo purification using techniques suited to membrane proteins. These might include detergent solubilization followed by affinity chromatography, particularly if the recombinant protein includes affinity tags. Subsequent characterization might involve mass spectrometry, circular dichroism spectroscopy, or structural analyses through crystallography or cryo-electron microscopy. These approaches would provide insights into the protein's molecular properties and structural features.

Applications and Research Significance

The production of recombinant ALIS2 has significant implications for research into plant membrane biology and phospholipid transport mechanisms. By making this protein available in purified form, researchers can conduct detailed studies of its structure, interactions, and function.

Experimental Applications

Recombinant ALIS2 serves numerous experimental purposes, including structural studies, interaction analyses, and functional assays. Researchers can use purified ALIS2 to investigate its binding to different ALA proteins, assess how these interactions influence phospholipid flipping activity, and explore potential regulatory mechanisms. Additionally, recombinant ALIS2 can serve as an antigen for antibody production, facilitating immunological detection of the native protein in plant tissues.

Contributions to Understanding Plant Physiology

Research involving recombinant ALIS2 contributes to our broader understanding of plant physiology, particularly membrane dynamics and vesicular transport. By elucidating the role of ALIS2 in phospholipid flipping, researchers gain insights into fundamental cellular processes that influence plant development, stress responses, and environmental adaptation. This knowledge may eventually inform agricultural applications or biotechnological innovations.

Current Research and Future Directions

Research on ALIS2 and related proteins continues to advance our understanding of membrane biology in plants. Current investigations likely focus on detailed characterization of ALIS2's structure, its specific interactions with different ALA proteins, and the functional consequences of these interactions.

Recent Findings

While the search results don't provide recent findings specifically about ALIS2, research on P4-ATPases and their β-subunits has revealed important insights into their function. Studies have demonstrated that the α-subunit (ALA protein) determines lipid specificity and cellular targeting, while the role of β-subunits like ALIS2 may be more complex than initially thought . These findings suggest that ALIS2 may serve functions beyond simply stabilizing or activating its ALA partners.

Future Research Directions

Future research on ALIS2 may explore several promising directions. These could include detailed structural analyses to understand precisely how ALIS2 interacts with ALA proteins, investigations into potential regulatory mechanisms that control complex formation or activity, and studies of how ALIS2-containing complexes participate in specific cellular processes. Additionally, comparative analyses of different ALIS proteins might reveal specialized functions or subcellular localizations that contribute to the diverse roles of phospholipid flippases in plant cells.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery time estimates, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ALIS2; At5g46150; MCL19.21; Putative ALA-interacting subunit 2; AtALIS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ALIS2
Target Protein Sequence
MMEVEGSMNRAPDQSSFLRSRRSKALYQFKQQKLPACKPVLTPISVITVFMLMGFVFIPI GLITLRASRDAIEIIDRYDVECIPEEYRTNKLLYITDSSIPKNCTRYLKVQKYMKAPIFI YYQLDNYYQNHRRYVKSRSDQQLLHGLEYSHTSSCEPEESSNGLPIVPCGLIAWSMFNDT FTFSRERTKLNVSRNNIAWKSDREHKFGKNVYPINFQNGTLIGGAKLDPKIPLSDQEDFI VWMRAAALLSFRKLYGRIEEDLEPGKVVEVNLMNNYNTYSFSGQKKLILSTSNWLGGRND FLGITYLVVGSSSIVISIIFMLLHLKNPRPYGDNSWNKKSLSS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G46150

STRING: 3702.AT5G46150.1

UniGene: At.29969

Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves, stems, flowers and siliques.

Q&A

What is the function of ALIS2 in Arabidopsis thaliana?

ALIS2 functions as a beta-subunit that interacts with Aminophospholipid ATPases (ALAs), particularly facilitating the proper localization and functionality of ALA flippases. Similar to other ALIS proteins (ALIS1, ALIS3, ALIS5), ALIS2 likely enables ALAs to exit the endoplasmic reticulum (ER) and reach their final cellular destination . Without ALIS partners, ALA proteins often remain trapped in the ER, rendering them non-functional. The interaction between ALIS2 and various ALA proteins (like ALA1 and ALA2) is critical for processes including antiviral immunity and membrane phospholipid asymmetry maintenance .

How does ALIS2 differ from other ALIS family members?

ALIS2 belongs to the same family as ALIS1, ALIS3, and ALIS5, sharing structural similarities but potentially having distinct expression patterns and ALA partner preferences. While specific ALIS2 information is limited in current research, studies of other ALIS members indicate they all facilitate ALA transport from the ER to their final destinations, but may differ in tissue-specific expression, ALA partner preferences, and regulatory mechanisms . The functional redundancy between ALIS family members is evidenced by observations that ALIS1, ALIS3, and ALIS5 can all promote proper localization of ALA2 and ALA3, suggesting potentially similar capabilities for ALIS2 .

What experimental techniques are used to study ALIS2-ALA interactions?

Several experimental approaches are employed to study ALIS2-ALA interactions:

  • Yeast complementation assays: Using yeast strains deficient in flippase activity to test whether co-expression of recombinant ALA and ALIS proteins can restore function .

  • Fluorescent protein fusion localization: Tagging ALIS2 and ALAs with fluorescent proteins (like GFP) to visualize their subcellular localization through confocal microscopy .

  • Co-immunoprecipitation: Evaluating physical interactions between ALIS2 and ALA proteins.

  • Mutant phenotype analysis: Comparing wild-type, single, double, and triple mutants to assess functional relationships, as demonstrated with ALA1/ALA2 studies .

  • Lipid translocation assays: Measuring the flipping of fluorescently-labeled phospholipids across membranes to assess functional activity of ALA-ALIS complexes.

How should I design experiments to study ALIS2 function in Arabidopsis?

When designing experiments to study ALIS2 function, implement a systematic approach following these methodological principles:

  • Define your variables clearly:

    • Independent variable: ALIS2 genetic status (wild-type, mutant, overexpression)

    • Dependent variables: Phenotypic traits, subcellular localization of ALAs, lipid composition, stress responses, etc.

    • Control for extraneous variables: Growth conditions, genetic background, developmental stage

  • Generate appropriate genetic materials:

    • ALIS2 T-DNA insertion mutants

    • ALIS2-ALA double/triple mutants to assess functional redundancy

    • Complementation lines expressing ALIS2 under native or constitutive promoters

    • Fluorescently-tagged ALIS2 constructs for localization studies

  • Employ a between-subjects experimental design:

    • Compare different genotypes (wild-type vs. mutants) under identical conditions

    • Use randomized complete block design to account for environmental variation

  • Include appropriate controls:

    • Wild-type plants as negative controls

    • Known ALA/ALIS mutants as positive controls

    • Multiple independent transgenic lines to confirm phenotypes

  • Validate results with complementary approaches:

    • Combine genetic, biochemical, and imaging methodologies

    • Perform rescue experiments to confirm specificity

What are the best methods for producing recombinant ALIS2 protein?

To produce high-quality recombinant ALIS2 protein for biochemical and structural studies:

  • Expression system selection:

    Expression SystemAdvantagesDisadvantagesBest Use Case
    E. coliFast growth, high yieldMay not provide proper folding or post-translational modificationsInitial protein characterization
    YeastEukaryotic processing, moderate yieldLonger growth time than bacteriaFunctional studies requiring proper folding
    Insect cellsHigh-quality eukaryotic processingMore complex and expensiveStructural biology applications
    Plant expressionNative modificationsLower yield, time-consumingPlant-specific interaction studies
  • Fusion tags optimization:

    • N-terminal 6xHis or GST tags for purification

    • Consider addition of a tobacco etch virus (TEV) protease cleavage site

    • For membrane proteins like ALIS2, include solubilization tags such as maltose-binding protein

  • Solubilization and purification protocol:

    • Use mild detergents (DDM, LMNG) or amphipols for membrane protein extraction

    • Implement two-step purification (affinity chromatography followed by size exclusion)

    • Optimize buffer conditions (pH 7.0-8.0, 150-300 mM NaCl) to maintain stability

  • Quality control measures:

    • SDS-PAGE and western blot to confirm purity and identity

    • Circular dichroism to assess secondary structure integrity

    • Dynamic light scattering to evaluate homogeneity

How can I verify ALIS2-ALA interactions in planta?

To verify ALIS2-ALA interactions in Arabidopsis:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Express split YFP/GFP fragments fused to ALIS2 and ALAs in Arabidopsis protoplasts or Nicotiana benthamiana

    • Visualize reconstituted fluorescence using confocal microscopy to confirm interactions

  • Co-immunoprecipitation from plant tissues:

    • Express epitope-tagged versions (HA, FLAG, Myc) of ALIS2 and ALA proteins

    • Immunoprecipitate protein complexes using tag-specific antibodies

    • Detect interaction partners via western blotting

  • Subcellular co-localization studies:

    • Generate plants expressing fluorescently-tagged ALIS2 and ALA proteins

    • Compare localization patterns in wild-type, single, and double mutant backgrounds

    • Observe whether ALIS2 facilitates the exit of ALAs from the ER to their final destinations

  • Genetic interaction analysis:

    • Create and phenotype alis2 ala double mutants

    • Assess whether phenotypes are additive or epistatic

    • Compare with other alis ala combinations for functional redundancy insights

How does ALIS2 contribute to ALA-mediated antiviral immunity?

ALIS2 likely contributes to antiviral immunity through facilitating proper trafficking and function of ALA flippases. While specific ALIS2 data is limited, research on related proteins provides insights into potential mechanisms:

  • Membrane composition regulation:

    • ALIS2-ALA complexes may modify membrane phospholipid composition, affecting viral replication complex formation

    • Phospholipid asymmetry maintenance could influence host-virus interactions at cellular membranes

  • RNAi pathway support:

    • ALA1 and ALA2 have been identified as novel components in the RNA interference (RNAi) pathway

    • These ALAs function additively with RDR1 and RDR6 to mediate antiviral immunity

    • ALIS2 might facilitate proper localization of ALAs to sites of RNAi activity

  • Experimental evidence from ALA studies:

    • The ala1-2 single mutant shows mild susceptibility to CMV2aTΔ2b (a 2b-deficient Cucumber Mosaic Virus)

    • Double mutants (ala1-2 rdr6, ala1-2 rdr1) exhibit increased susceptibility

    • The triple mutant ala1-2 rdr1 rdr6 displays the most severe symptoms with stunted leaves and chlorosis

To investigate ALIS2's specific role in this process, researchers should generate alis2 single and alis2 ala1/2 double mutants and assess their response to viral challenge compared to established ala mutants.

What is the structural basis for ALIS2 specificity toward different ALA partners?

The structural determinants of ALIS2 specificity toward different ALA partners remain largely undefined, but likely involve:

  • Protein domain architecture:

    • ALIS proteins contain CDC50 domains that interact with P4-ATPase domains of ALAs

    • Specific binding interfaces may determine preferential interactions between particular ALIS-ALA pairs

    • Critical amino acid residues in transmembrane domains likely mediate protein-protein recognition

  • Experimental approaches to determine specificity:

    • Site-directed mutagenesis of conserved vs. divergent residues

    • Domain swapping between different ALIS proteins

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Cryo-electron microscopy of ALIS2-ALA complexes

  • Co-evolutionary analysis:

    • Comparing evolutionary rates between ALIS and ALA family members

    • Identifying co-evolved residues that might form interaction networks

    • Using this information to predict preferential binding partners

How do environmental stresses modulate ALIS2-ALA interactions?

Environmental stresses likely influence ALIS2-ALA interactions through:

  • Transcriptional regulation:

    • Stress conditions may alter expression patterns of ALIS2 and ALAs

    • Virus infection has been shown to induce expression of some ALA family members (e.g., ALA7 and ALA10)

    • Temperature stress affects ALA function in pollen tubes, suggesting potential for stress-regulated ALIS-ALA interactions

  • Post-translational modifications:

    • Phosphorylation, ubiquitination, or other modifications might regulate ALIS2-ALA binding affinity

    • Stress-activated kinases could modulate these interactions through direct protein modification

  • Membrane environment changes:

    • Stress-induced alterations in membrane fluidity and composition

    • Temperature, oxidative stress, or pathogen challenge may trigger reorganization of membrane domains where ALIS2-ALA complexes function

  • Experimental approaches:

    • Transcriptome analysis under various stress conditions

    • Co-immunoprecipitation under stress vs. control conditions

    • FRET-based interaction assays in living plants subjected to stress treatments

How can I overcome expression difficulties when working with recombinant ALIS2?

Membrane proteins like ALIS2 present numerous expression challenges. Consider these solutions:

  • Optimizing expression conditions:

    ChallengeSolutionImplementation
    Poor expressionLower induction temperatureReduce to 16-20°C during induction phase
    Protein aggregationAdd solubilizing agentsInclude 5-10% glycerol and mild detergents
    Toxicity to hostUse tightly regulated promotersSwitch to pET vectors with T7lac promoter
    Poor membrane integrationAdd signal sequencesFuse with established membrane protein leader sequences
    Proteolytic degradationInclude protease inhibitorsAdd PMSF, EDTA, and complete protease inhibitor cocktail
  • Expression construct modifications:

    • Try both N- and C-terminal tags to identify optimal configuration

    • Remove putative problematic regions (flexible loops) that might cause aggregation

    • Codon-optimize the sequence for your expression system

    • Co-express with ALA partners to promote proper folding and stability

  • Alternative expression systems:

    • Cell-free translation systems for toxic proteins

    • Mammalian cell expression for challenging membrane proteins

    • Consider using Pichia pastoris for higher membrane protein yields

What controls should be included when analyzing phenotypes of alis2 mutants?

When analyzing alis2 mutant phenotypes, include these essential controls:

  • Genetic controls:

    • Wild-type plants of identical ecotype background

    • Multiple independent alis2 mutant alleles to confirm phenotype specificity

    • Complementation lines expressing ALIS2 under native promoter

    • Other alis single mutants (alis1, alis3, alis5) to assess family member-specific effects

    • alis2 ala double mutants to evaluate genetic interactions

  • Technical controls:

    • Mock treatments alongside experimental treatments

    • Randomized experimental design with appropriate replication

    • Blind scoring of phenotypes when subjective assessment is required

    • Positive controls with known phenotypes of similar severity

  • Developmental controls:

    • Age-matched plants at equivalent developmental stages

    • Multiple timepoints to distinguish between developmental delays vs. true defects

    • Assessment under multiple growth conditions

  • Molecular validation:

    • RT-PCR or RNA-seq to confirm altered ALIS2 expression

    • Protein-level verification using antibodies or tagged versions

    • Reversion of phenotype with wild-type transgene introduction

What emerging technologies could advance our understanding of ALIS2 function?

Several cutting-edge technologies could significantly enhance ALIS2 research:

  • CRISPR-Cas9 genome editing:

    • Generate precise mutations in ALIS2 functional domains

    • Create tagged versions at endogenous loci to maintain native expression patterns

    • Perform high-throughput screening with CRISPR libraries targeting ALA-ALIS pathways

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize nanoscale organization of ALIS2-ALA complexes

    • Live-cell single-molecule tracking to monitor dynamics of ALIS2-ALA interactions

    • Correlative light and electron microscopy to link protein localization with membrane ultrastructure

  • Proteomics approaches:

    • Proximity labeling (BioID, APEX) to identify novel ALIS2 interactors in native plant tissues

    • Quantitative interaction proteomics under different environmental conditions

    • Phosphoproteomics to map regulatory post-translational modifications

  • Structural biology methods:

    • Cryo-electron microscopy of ALIS2-ALA complexes

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic interactions

    • AlphaFold2 or RoseTTAFold structure prediction validated by experimental approaches

How might ALIS2 function in regulating plant responses to climate change stressors?

ALIS2 may play important roles in plant adaptation to climate change stressors:

  • Temperature stress responses:

    • ALA6 and ALA7 are critical for pollen development under temperature stress

    • ALIS2 might similarly facilitate ALA function during temperature fluctuations

    • Changes in membrane fluidity during temperature stress likely require coordinated phospholipid flippase activity

  • Drought and salinity tolerance:

    • Membrane phospholipid composition affects water permeability and ion transport

    • ALIS2-dependent ALA localization could be crucial for maintaining membrane integrity during water stress

    • Phospholipid asymmetry may influence signaling pathways related to ABA responses

  • Pathogen resistance under changing climate:

    • Climate change affects plant-pathogen interactions

    • ALIS2's potential role in ALA-mediated antiviral immunity suggests importance in climate-modulated disease resistance

    • Changing pathogen pressures might select for altered ALIS2-ALA interactions

  • Research approaches:

    • Examine alis2 mutant responses to combined stresses (e.g., heat+drought, heat+pathogen)

    • Investigate natural variation in ALIS2 sequences from Arabidopsis ecotypes adapted to different climates

    • Use recombinant inbred lines to map stress-tolerance QTLs associated with ALIS2

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.