Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 4 (ALIS4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ALIS4; At1g16360; F3O9.16; Putative ALA-interacting subunit 4; AtALIS4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ALIS4
Target Protein Sequence
MSTKKHNLLANFASSDSRFTQQELPACKPILTPKWVILTFLVSGVVFIPLGVICLFASQG VIEIVDRYDTDCIPLSSRDNKVRYIQGLEDKRCNRTITVTKTMKNPVYVYYQLENYYQNH RRYVKSRQDGQLRSPKDEHETKSCAPEDTLGGQPIVPCGLVAWSLFNDTYDFTRNNQKLP VNKKDISWKSDRESKFGKNVFPKNFQKGSLIGGKSLDQDIPLSEQEDLIVWMRTAALPTF RKLYGKIDTDLQAGDTIKVLLQNNYNTYSFNGKKKLVLSTTSWLGGRNDFLGIAYLTVGS ICLFLAVSFSVLYLAKPRQLGDPSYLSWNRSAGGGR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G16360

STRING: 3702.AT1G16360.1

UniGene: At.41886

Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in flowers. May be restricted to pollen grains.

Q&A

How does ALIS4 expression differ from other ALIS family members?

ALIS4 exhibits unique tissue-specific expression compared to other ALIS family members. While ALIS1, ALIS2, ALIS3, and ALIS5 are expressed in most Arabidopsis tissues, ALIS4 expression is remarkably restricted, being almost exclusively expressed in pollen grains . This distinct expression pattern was confirmed through RT-PCR analysis, which detected ALIS4 transcripts only in flower tissue, suggesting a specialized role for ALIS4 in reproductive processes .

This tissue-specific expression pattern provides important insights for researchers designing experiments:

ALIS ProteinExpression PatternDetection Method
ALIS1Most tissuesRT-PCR
ALIS2Most tissuesRT-PCR
ALIS3Most tissuesRT-PCR
ALIS4Almost exclusively in pollenRT-PCR, Genevestigator microarray
ALIS5Most tissuesRT-PCR

When designing experiments involving ALIS4, researchers should consider using flower tissues or pollen-specific systems to ensure adequate expression levels.

What is the functional relationship between ALIS4 and P4-ATPases?

The ALIS family, including ALIS4, functions as obligate β-subunits for P4-ATPases (ALA proteins) in Arabidopsis. This relationship has significant functional implications:

  • ER Export Dependency: P4-ATPases like ALA2 and ALA3 are retained in the endoplasmic reticulum (ER) when expressed in plants without an ALIS protein. Only after co-expression with an ALIS β-subunit can they exit the ER .

  • Catalytic Activation: ALA proteins are catalytically inactive in the absence of an ALIS protein. The association with an ALIS protein is required for the P4-ATPase to gain functionality .

  • Trafficking Determination: While ALIS proteins are necessary for ER export of P4-ATPases, research indicates that the final subcellular localization is determined by the ALA catalytic α-subunit, not by the associated ALIS protein .

  • Lipid Specificity: Studies with ALA2 and ALA3 show that their lipid substrate specificities remain unaffected by the particular ALIS protein they interact with, suggesting that lipid specificity determinants reside in the ALA catalytic subunit rather than the ALIS protein .

This relationship represents a fascinating example of protein complex formation where one component (ALIS) is required for the proper trafficking and activation of another (ALA), without influencing its functional specificity.

How do researchers determine if ALIS4 interacts with specific ALA proteins?

Determining ALIS4-ALA protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): This technique can demonstrate physical interaction between ALIS4 and ALA proteins. For example, studies with ALA3 and ALIS1 showed they could be co-purified in a detergent-resistant protein complex, indicating direct interaction .

  • Functional Complementation Assays: Researchers can express ALIS4 and ALA proteins in yeast mutants lacking endogenous P4-ATPases (such as Δdrs2Δdnf1Δdnf2) and assess if the cold-sensitive phenotype is rescued. This approach was used to demonstrate that ALA2 requires an ALIS protein for functionality .

  • Subcellular Co-localization: Fluorescent protein tagging (like YFP and GFP) can be used to visualize the localization of both ALIS4 and ALA proteins when expressed individually or together. Studies have shown that ALIS proteins remain in the ER when expressed alone but relocate to different cellular compartments when co-expressed with ALA proteins .

  • Phospholipid Translocation Assays: Measuring the flipping of fluorescently labeled phospholipids in cells expressing both ALIS4 and ALA proteins can demonstrate functional interaction. This approach has shown that different ALA-ALIS combinations can promote phosphatidylserine translocation across membranes .

When investigating a potential interaction between ALIS4 and a specific ALA protein, researchers should employ at least two of these complementary methods to establish both physical and functional interaction.

What are the optimal conditions for expression and purification of recombinant ALIS4?

Based on established protocols for recombinant ALIS4 production:

Expression System:

  • E. coli has been successfully used as an expression host for ALIS4 .

  • The protein is typically expressed with an N-terminal His-tag to facilitate purification .

Purification Protocol:

  • Extraction: Use a Tris-based buffer optimized for membrane proteins.

  • Purification: Affinity chromatography using the His-tag.

  • Storage: The purified protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C .

Critical Storage Considerations:

  • Working aliquots can be stored at 4°C for up to one week.

  • Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity .

  • For reconstitution, it's recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to 0.1-1.0 mg/mL .

Optimization Recommendations:
If expression yields are low, consider:

  • Codon optimization for E. coli

  • Lower induction temperatures (16-20°C)

  • Testing different E. coli strains optimized for membrane protein expression

  • Adding stabilizing agents like glycerol or specific detergents during purification

What methodological approaches can be used to study ALIS4 localization in plant cells?

Studying ALIS4 localization in plant cells requires specialized techniques:

  • Fluorescent Protein Tagging:

    • Creating ALIS4:YFP or ALIS4:GFP fusion constructs for transient expression in plant systems like Nicotiana benthamiana .

    • Co-expression with established organelle markers (e.g., GFP:HDEL for ER localization) .

    • Analysis by confocal microscopy to determine subcellular localization.

  • Immunolocalization:

    • Development of ALIS4-specific antibodies for immunofluorescence.

    • Fixation and permeabilization of plant tissues followed by antibody labeling.

    • This approach preserves native protein levels and avoids potential artifacts from overexpression.

  • Fractionation Studies:

    • Isolation of different organelle fractions from plant tissues.

    • Western blot analysis using anti-ALIS4 antibodies to detect the protein in specific cellular fractions.

  • Co-localization with ALA Proteins:

    • Co-expression of tagged ALIS4 with different ALA proteins to assess if ALIS4 localization changes.

    • Research has shown that ALIS proteins remain in the ER when expressed alone but relocate to different cellular compartments when co-expressed with ALA proteins .

What is the evolutionary significance of ALIS4 compared to other ALIS family members?

The evolutionary significance of ALIS4 can be examined through several lenses:

  • Sequence Conservation: ALIS proteins share 27-30% sequence identity with yeast Cdc50p, indicating ancient evolutionary origins of this protein family . This conservation suggests fundamental roles in eukaryotic cell biology.

  • Functional Specialization: Unlike other ALIS proteins that are broadly expressed, ALIS4's restricted expression in pollen suggests evolutionary specialization for reproductive functions . This specialization may represent adaptation to the unique membrane dynamics required during pollen development and fertilization.

  • Interaction Partners: Analyzing whether ALIS4 interacts with specific ALA proteins not recognized by other ALIS family members could reveal co-evolution of interacting partners.

  • Comparative Analysis Across Species:

SpeciesALIS4 HomologExpression PatternKnown Function
Arabidopsis thalianaALIS4Pollen-specificPutative P4-ATPase β-subunit
Other plantsVarious Cdc50-like proteinsVariableP4-ATPase β-subunits
YeastCdc50pUbiquitousRequired for P4-ATPase function

The pollen-specific expression of ALIS4 compared to the broader expression of other ALIS proteins suggests that ALIS4 may have evolved specialized functions in male gametophyte development or function. This specialization could represent an adaptation to the unique membrane dynamics required during pollen tube growth and fertilization.

How does ALIS4 function differ from other ALIS family members in Arabidopsis?

Comparative analysis of ALIS family members reveals both similarities and differences:

  • Expression Patterns:

    • ALIS1, ALIS2, ALIS3, and ALIS5: Broadly expressed across most tissues

    • ALIS4: Distinctly expressed almost exclusively in pollen
      This expression difference suggests specialized functions for ALIS4 in reproductive processes.

  • Functional Complementation:
    Studies with ALA2 showed that ALIS1, ALIS3, and ALIS5 could all enable ALA2 to complement yeast P4-ATPase mutants, but with different efficiencies:

    • ALIS1 and ALIS5: Most efficient at complementing the cold-sensitive phenotype

    • ALIS3: Less effective for cold sensitivity, but more potent in supporting yeast growth on elevated Cobalt and Zinc concentrations

    These differences suggest subtle functional distinctions between ALIS proteins that might be particularly relevant when studying ALIS4.

  • Subcellular Localization:
    All ALIS proteins are retained in the ER when expressed alone, but relocate to different compartments when co-expressed with ALA proteins. The final localization appears to be determined by the ALA protein rather than the specific ALIS protein .

To specifically study ALIS4's unique functions:

  • Focus on pollen-specific processes

  • Compare ALIS4 with other ALIS proteins in pollen

  • Investigate potential specialized interactions with pollen-expressed ALA proteins

What are the methodological challenges in studying protein-protein interactions between ALIS4 and ALA proteins?

Studying ALIS4-ALA interactions presents several unique challenges:

  • Expression System Limitations:

    • ALIS4's pollen-specific expression makes native isolation challenging

    • Membrane protein complexes are notoriously difficult to express in heterologous systems

    • E. coli expression may not provide proper post-translational modifications

  • Structural Complexities:

    • Both ALIS4 and ALA proteins are transmembrane proteins

    • The interaction likely involves transmembrane domains, which are difficult to study with conventional protein-protein interaction methods

  • Functional Assessment Challenges:

    • P4-ATPase activity assays typically measure phospholipid flipping

    • These assays require proper membrane reconstitution of the complex

    • Distinguishing ALIS4-specific effects from those of other ALIS proteins

Recommended methodological approaches to overcome these challenges:

  • Split-ubiquitin Yeast Two-hybrid System: Specifically designed for membrane protein interactions

  • FRET/BRET Analysis: For studying interactions in living cells

  • Microscale Thermophoresis: Can detect interactions with minimal protein amounts

  • Native Mass Spectrometry: For direct visualization of intact membrane protein complexes

  • Cryo-electron Microscopy: For structural characterization of the complex

For genetic studies in plants, researchers should consider:

  • Pollen-specific promoters for expression of tagged proteins

  • Single-cell approaches for studying pollen tubes

  • Development of ALIS4-specific antibodies for immunoprecipitation

What are the promising research avenues for understanding ALIS4's role in plant reproduction?

Given ALIS4's pollen-specific expression, several research directions could yield significant insights:

  • Pollen Membrane Dynamics:

    • Investigate whether ALIS4-ALA complexes regulate phospholipid asymmetry during pollen tube growth

    • Examine if ALIS4 plays a role in the rapid membrane synthesis required during pollen tube elongation

    • Study potential roles in regulating membrane curvature during pollen germination

  • Reproductive Adaptation:

    • Compare ALIS4 sequences and expression patterns across plant species with different reproductive strategies

    • Investigate whether ALIS4 has evolved in response to specific pollination mechanisms

    • Examine if ALIS4 contributes to reproductive isolation mechanisms

  • Signaling Roles:

    • Study whether ALIS4-dependent phospholipid flipping contributes to signaling events during fertilization

    • Investigate potential roles in calcium signaling, which is crucial for pollen tube guidance

    • Examine possible interactions with proteins involved in pollen-stigma recognition

  • Stress Responses in Reproduction:

    • Analyze whether ALIS4 contributes to pollen thermotolerance through membrane stabilization

    • Investigate potential roles in drought or salt stress responses during reproduction

    • Study if ALIS4 expression or function is altered under stress conditions

These research directions could be pursued using a combination of genetic approaches (CRISPR/Cas9-mediated mutations), cell biology techniques (live-cell imaging of fluorescently tagged proteins), biochemical methods (lipid flipping assays), and systems biology approaches (interaction networks and transcriptomics).

How might technological advances enhance our understanding of ALIS4 function and interactions?

Emerging technologies offer promising approaches for deepening our understanding of ALIS4:

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize ALIS4 distribution in pollen membranes with nanometer precision

    • Live-cell imaging with improved fluorescent sensors for phospholipid asymmetry

    • Correlative light and electron microscopy to link ALIS4 localization with membrane ultrastructure

  • Structural Biology Innovations:

    • Cryo-electron microscopy for determining the structure of ALIS4-ALA complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • AlphaFold2 or similar AI-based structural prediction tools to model ALIS4 structure and interactions

  • Single-Cell Approaches:

    • Single-pollen cell transcriptomics to correlate ALIS4 expression with other genes

    • Single-cell proteomics to identify pollen-specific interaction partners

    • CRISPR-based lineage tracing to track cells with altered ALIS4 function

  • Synthetic Biology Tools:

    • Optogenetic control of ALIS4-ALA interactions to study temporal aspects of their function

    • Engineered ALIS4 variants with altered specificity to probe structure-function relationships

    • Reconstitution of minimal membrane systems with defined lipid compositions to study ALIS4-dependent flipping

  • Computational Approaches:

    • Machine learning to predict functional consequences of ALIS4 variants

    • Molecular dynamics simulations to model phospholipid interactions with ALIS4-ALA complexes

    • Systems biology modeling of membrane dynamics during pollen tube growth

Implementing these advanced approaches could resolve longstanding questions about ALIS4 function and potentially reveal unexpected roles in plant reproduction and development.

What are the key considerations for designing experiments involving recombinant ALIS4?

Researchers planning experiments with recombinant ALIS4 should consider:

  • Expression Systems:

    • E. coli has been successfully used for ALIS4 expression

    • For functional studies, consider co-expression with ALA proteins in yeast or plant systems

    • For plant expression, use pollen-specific promoters to mimic native expression patterns

  • Protein Stability:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Functional Assays:

    • Always include a co-expressed ALA protein for functional studies

    • Consider using yeast complementation assays as demonstrated for other ALIS proteins

    • For lipid flipping assays, include appropriate controls with other ALIS proteins

  • Tagged Versions:

    • N-terminal His-tags have been successfully used

    • C-terminal tags may interfere with membrane insertion

    • For localization studies, fluorescent protein tags should be placed at positions that don't disrupt function

  • Tissue Specificity:

    • Remember ALIS4's pollen-specific expression when designing in planta experiments

    • Use appropriate tissue-specific controls when comparing ALIS4 with other ALIS proteins

How can inconsistent results in ALIS4 research be reconciled and addressed methodologically?

When facing inconsistent results in ALIS4 research, consider these methodological approaches:

  • Expression Level Variability:

    • Quantify protein expression levels in each experiment

    • Use inducible expression systems for controlled expression

    • Consider creating stable transgenic lines for consistent expression

  • Functional Redundancy:

    • Test multiple ALIS proteins in parallel experiments

    • Create double or triple mutants to address functional redundancy

    • Use tissue-specific knockdown approaches to target ALIS4 in pollen

  • Technical Variations:

    • Standardize protein purification protocols

    • Use internal controls for activity assays

    • Document detailed methods including buffer compositions and incubation times

  • Biological Variability:

    • Increase biological replicates

    • Control growth conditions rigorously

    • Consider developmental timing, especially for pollen studies

  • Experimental Design Improvements:

    • Use orthogonal approaches to verify results

    • Include positive and negative controls in all experiments

    • Blind analysis of results when possible

When publishing ALIS4 research, we recommend detailed reporting of:

  • Exact construct sequences including tags

  • Expression conditions including induction parameters

  • Purification methods and buffer compositions

  • Storage conditions and protein stability assessments

  • Detailed methods for functional assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.