Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 13 (CNGC13)

Shipped with Ice Packs
In Stock

Description

Introduction to the CNGC Family

The Arabidopsis thaliana genome contains 20 CNGC genes encoding putative non-selective ion channels that have been implicated in various physiological processes. These channels participate in calcium signaling networks related to pathogen defense, development, thermotolerance, and environmental stress responses . CNGCs function primarily as calcium-permeable channels, though they can transport various cations with different selectivities .

CNGCs are characterized by their ability to be regulated by cyclic nucleotides and, in many cases, by calmodulin. They typically contain six transmembrane domains with a pore region and cyclic nucleotide-binding domain, making them important components of plant cell signaling mechanisms . Within this diverse family, individual members have evolved specialized functions, with CNGC13 demonstrating particularly important roles in heavy metal ion transport.

Gene Information and Nomenclature

The CNGC13 gene in Arabidopsis thaliana is also known by several alternative designations, including:

  • ATCNGC13

  • Cyclic nucleotide-gated channel 13

  • F3I3.1

  • F3I3_1

This gene shows variable distribution across plant species. While present in Arabidopsis thaliana, Citrus sinensis, Atalantia buxfolia, and Poncirus trifoliata, it is notably absent in Citrus grandis and Citrus reticulata, suggesting evolutionary selection pressures or functional specialization across species .

Expression Systems and Methodology

Recombinant CNGC13 can be produced through various expression systems, with E. coli being a common platform. The recombinant protein is typically expressed with an N-terminal histidine tag to facilitate purification and detection . Alternative expression systems include cell-free expression methods, which can be advantageous for membrane proteins that might be challenging to express in cellular systems .

Table 1: Expression Systems for Recombinant CNGC13 Production

Expression SystemAdvantagesTag OptionsTypical Yield
E. coliCost-effective, high yieldHis-tag (N-terminal)Variable, protein-dependent
Cell-free expressionAvoids toxicity issues, rapidHis-tag, GSTLower than cellular systems
Yeast/BaculovirusPost-translational modificationsHis-tag, various othersModerate

Ion Transport and Metal Toxicity

CNGC13 plays a significant role in heavy metal ion transport in Arabidopsis. Research has demonstrated that AtCNGC13 is involved in both lead (Pb²⁺) and cadmium (Cd²⁺) toxicity responses. Mutation studies have shown that AtCNGC13 knockouts result in reduced lead accumulation in plants, providing functional evidence for its role in heavy metal uptake and transport .

This function aligns with the broader role of CNGCs as non-selective cation channels that can mediate the uptake of both essential nutrients and toxic elements. The involvement of CNGC13 in heavy metal transport suggests potential applications in phytoremediation strategies and crop improvement for metal tolerance .

Relationship with Other CNGC Family Members

While CNGC13 has distinct functions, understanding its relationship with other family members provides valuable context. The CNGC family in Arabidopsis is divided into multiple phylogenetic groups, with certain members like CNGC2 and CNGC4 being implicated in plant defense responses, while others like CNGC1 and CNGC10 are associated with heavy metal and cation transport .

Some evidence suggests functional overlap between family members. For instance, both CNGC13 and CNGC1 are involved in lead transport, while CNGC13, CNGC11, CNGC16, and CNGC20 all function in cadmium toxicity responses, suggesting potential redundancy or cooperation in these pathways .

Table 2: Comparative Functions of Selected CNGC Family Members

CNGC MemberPrimary FunctionsHeavy Metal ResponseTissue Expression
CNGC13Pb²⁺ and Cd²⁺ transportReduced Pb²⁺ accumulation in mutantsVarious tissues
CNGC1Heavy metal transportReduced Pb²⁺ accumulation in mutantsRoot tissues
CNGC2Plant defense, Ca²⁺ signalingNot primarily involvedVarious tissues
CNGC3Na⁺ and K⁺ uptakeNot primarily involvedCortical and epidermal root cells
CNGC11Cd²⁺ toxicityReduced metal accumulationVarious tissues

Research Applications

Recombinant CNGC13 serves as a valuable tool for investigating ion channel function and regulation in plants. Its applications include:

  1. Structure-function relationship studies of ion channels

  2. Protein-protein interaction analyses to identify regulatory partners

  3. Electrophysiological characterization of ion transport properties

  4. Development of antibodies for CNGC13 detection in planta

  5. In vitro assays for cyclic nucleotide binding and channel activation

These applications provide insights into fundamental aspects of plant ion homeostasis and signaling mechanisms .

Biotechnological and Agricultural Implications

Understanding CNGC13 function has significant implications for plant biotechnology and agriculture:

  1. Engineering plants with modified heavy metal uptake capabilities for phytoremediation

  2. Developing crops with enhanced resistance to heavy metal toxicity

  3. Improving plant nutrient uptake efficiency through channel modification

  4. Understanding calcium signaling pathways related to stress responses

  5. Potential targets for enhancing plant resilience to environmental stresses

The role of CNGC13 in heavy metal ion transport makes it particularly relevant for applications in contaminated soil remediation and crop improvement for metal-contaminated environments .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CNGC13; At4g01010; F3I3.1; Putative cyclic nucleotide-gated ion channel 13; Cyclic nucleotide- and calmodulin-regulated ion channel 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-696
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CNGC13
Target Protein Sequence
MAFGRNNRVRFRDWISEGTEYGYGRNKARPSLNTVLKNVRRGLKKPLSFGSHNKKRDSNS STTTQKNIINPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHRNLEIAA SVLRTFIDAFYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDLLSIL PLPQLVVLAVIPNVNKPVSLITKDYLITVIFTQYIPRILRIYPLYTEVTRTSGIVTETAW AGAAWNLSLYMLASHVFGALWYLISVEREDRCWREACEKIPEVCNFRFLYCDGNSSVRND FLTTSCPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQN LNTSKFVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRM LPDDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDE QLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPS DFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQH TFRFYSVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAITKRERNAASSSSLVAT LYASRFASNALRNLRTNNLPLLPPKPSEPDFSLRNP
Uniprot No.

Target Background

Function
Putative cyclic nucleotide-gated ion channel.
Database Links

KEGG: ath:AT4G01010

STRING: 3702.AT4G01010.1

UniGene: At.54067

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic and protein structure of Arabidopsis thaliana CNGC13?

Arabidopsis thaliana CNGC13 is one of 20 cyclic nucleotide-gated channel genes encoded in the Arabidopsis genome. Like other plant CNGCs, CNGC13 is characterized by:

  • Six transmembrane domains

  • A pore region between the fifth and sixth transmembrane domains

  • A cyclic nucleotide-binding domain (CNBD) in the C-terminal region

  • A calmodulin-binding domain that partially overlaps with the CNBD

CNGC13 belongs to Group I of the CNGC family based on phylogenetic analysis. The protein is predominantly localized to the plasma membrane, consistent with its role in ion transport across the cell membrane .

What physiological roles has CNGC13 been associated with in Arabidopsis thaliana?

Current research indicates that CNGC13 is primarily involved in:

  • Pb²⁺ uptake mechanisms

  • Negative regulation of Pb²⁺ tolerance

  • Potentially contributing to heavy metal ion transport pathways

Unlike some other CNGC family members that have well-characterized roles in multiple physiological processes, CNGC13's documented functions remain more limited to heavy metal transport, particularly lead (Pb²⁺) . This suggests either functional specialization or that additional roles remain to be discovered.

What expression systems are most effective for producing recombinant CNGC13 for functional studies?

For effective production of recombinant CNGC13, researchers should consider:

Heterologous Expression Systems:

  • Xenopus laevis oocytes: Ideal for electrophysiological studies, allowing direct measurement of channel activity through two-electrode voltage-clamp (TEVC) recording. This system has been successfully used for other CNGCs like CNGC11 and CNGC12 .

  • Yeast expression systems: Particularly useful for complementation assays to assess ion transport capabilities. The yeast system has been effective for characterizing CNGC3's function as an Na⁺ and K⁺ uptake mechanism .

  • HEK293 cells: Suitable for mammalian cell-based assays and calcium imaging studies.

Expression Vectors and Tags:

  • Use Gateway-compatible vectors for efficient cloning

  • Include epitope tags (His, GST, or GFP) to facilitate purification and localization studies

  • For membrane proteins like CNGCs, consider tags that minimize interference with membrane insertion

Purification Strategies:

  • Employ detergent screening to identify optimal solubilization conditions

  • Consider nanodiscs or liposome reconstitution for maintaining native-like membrane environment

  • Use affinity chromatography followed by size exclusion for high purity preparations

These approaches should be optimized specifically for CNGC13, as membrane proteins often require customized protocols for successful expression and purification .

What electrophysiological techniques are most suitable for characterizing CNGC13 channel properties?

For comprehensive electrophysiological characterization of CNGC13:

Patch-Clamp Techniques:

  • Whole-cell configuration: For measuring macroscopic currents across the entire cell membrane

  • Inside-out configuration: Particularly valuable for testing cytosolic regulators like cyclic nucleotides on channel activity

  • Outside-out configuration: Useful for examining effects of extracellular ligands

Two-Electrode Voltage Clamp (TEVC):

  • Well-established for CNGCs expressed in Xenopus oocytes

  • Allows characterization of:

    • Ion selectivity (Ca²⁺, K⁺, Na⁺)

    • Voltage dependence

    • Effects of cyclic nucleotides (cAMP, cGMP)

    • Regulation by calmodulin and calcium

Key Parameters to Measure:

  • Conductance

  • Ion selectivity

  • Voltage-dependent properties

  • Open probability

  • Kinetics of activation/inactivation

  • Response to cyclic nucleotides

  • Effects of potential regulators like calmodulin

Recent studies with other CNGCs have demonstrated that channels may not always be regulated by cyclic nucleotides as previously assumed. For example, CNGC11 and CNGC12 showed no response to dibutyryl-cAMP or 8Br-cGMP in electrophysiological studies, challenging the canonical view of plant CNGCs . Similar rigorous testing should be applied to CNGC13.

How can genetic approaches be used to study CNGC13 function in Arabidopsis?

Several genetic approaches are effective for investigating CNGC13 function:

Knockout and Knockdown Strategies:

  • T-DNA insertion lines (available through ABRC)

  • CRISPR/Cas9-generated knockouts

  • RNAi-mediated knockdown for partial loss-of-function

  • Compare phenotypes with existing characterized mutants like cngc1, cngc2/dnd1, and cngc4/dnd2

Genetic Complementation:

  • Transform knockout lines with native CNGC13 to confirm phenotype rescue

  • Use site-directed mutagenesis to create variants for structure-function studies

  • Cross with other cngc mutants to assess genetic interaction

Suppressor Screens:

  • Perform EMS mutagenesis on cngc13 knockout background to identify genetic suppressors

  • This approach successfully identified RDD1 as a component downstream of CNGC2 signaling

Tissue-Specific Expression:

  • Use tissue-specific promoters to determine where CNGC13 function is required

  • Combine with reporter genes like GUS or GFP to visualize expression patterns

Phenotypic Analysis:

  • Focus on lead (Pb²⁺) tolerance assays

  • Measure growth parameters under various heavy metal stresses

  • Analyze ionic content using ICP-MS to quantify metal accumulation

This multi-faceted genetic approach has been effective for characterizing other CNGCs and should yield valuable insights into CNGC13 function .

How do cyclic nucleotides regulate CNGC13 activity, and what experimental approaches best demonstrate this regulation?

While cyclic nucleotides are traditionally considered key regulators of CNGCs, their role in CNGC13 regulation requires careful investigation:

Approaches for Studying Cyclic Nucleotide Regulation:

  • Direct Binding Assays:

    • Microscale thermophoresis with purified CNBD domain

    • Isothermal titration calorimetry with cAMP and cGMP

    • Fluorescence-based binding assays

  • Electrophysiological Approaches:

    • Apply membrane-permeable cAMP/cGMP analogs (dibutyryl-cAMP, 8Br-cGMP)

    • Patch-clamp with cyclic nucleotides in pipette solution

    • Monitor channel activity changes in response to varying nucleotide concentrations

  • Critical Controls:

    • Generate binding-site mutants (based on conserved residues in the CNBD)

    • Compare with other CNGCs as positive and negative controls

Important Considerations:
Recent findings challenge the traditional view that all plant CNGCs are regulated by cyclic nucleotides. For example, CNGC11 and CNGC12 showed no response to dibutyryl-cAMP or 8Br-cGMP in electrophysiological studies . Therefore, it's crucial to directly test CNGC13 rather than assume cyclic nucleotide regulation based on sequence homology alone.

Additionally, it's important to test physiologically relevant concentrations of cyclic nucleotides, as some previous studies may have used concentrations significantly higher than those found in plant cells .

What role does calcium-calmodulin play in CNGC13 regulation, and how can this be experimentally characterized?

Calcium-calmodulin (Ca²⁺-CaM) regulation represents a critical aspect of CNGC function that should be thoroughly investigated for CNGC13:

Experimental Approaches:

  • Binding Studies:

    • Yeast two-hybrid assays with CNGC13 and various CaM isoforms

    • In vitro pull-down assays with GST-tagged CaM and His-tagged CNGC13 cytosolic domains

    • Bimolecular fluorescence complementation (BiFC) in plant protoplasts

  • Functional Analysis:

    • Electrophysiological recordings in presence/absence of CaM

    • Compare effects of apo-CaM versus Ca²⁺-bound CaM

    • Test multiple CaM isoforms (CaM1-7) and CaM-like proteins (CMLs)

  • Structure-Function Analysis:

    • Mutate predicted CaM-binding domain residues

    • Generate chimeric proteins with CaM-binding domains from other CNGCs

Important Insights from Other CNGCs:
Studies of CNGC12 demonstrated that different CaM isoforms have distinct effects on channel activity. For example, apo-CaM1 activated CNGC12, while CaM6 had no effect . This highlights the importance of testing multiple CaM isoforms rather than assuming uniform regulation.

For CNGC14, CaM7 inhibited channel activity while CaM2.2 had no effect . Such differential regulation may also apply to CNGC13 and should be systematically investigated.

The relationship between cyclic nucleotide and CaM regulation should also be explored, as these pathways may interact rather than function independently .

What is known about the phosphorylation of CNGC13 and its impact on channel function?

Phosphorylation represents an important regulatory mechanism for CNGCs that should be investigated for CNGC13:

Experimental Approaches:

  • Identification of Phosphorylation Sites:

    • Mass spectrometry-based phosphoproteomics

    • In silico prediction of phosphorylation sites

    • Conservation analysis with other CNGCs

  • Kinase Identification:

    • In vitro kinase assays with candidate kinases

    • Co-immunoprecipitation to identify interacting kinases

    • Genetic interactions with kinase mutants

  • Functional Impact:

    • Generate phospho-null (Ser/Thr to Ala) and phospho-mimetic (Ser/Thr to Asp/Glu) mutants

    • Test channel activity using electrophysiology

    • Evaluate impact on protein trafficking and stability

Insights from Other CNGCs:
Recent research with CNGC5, CNGC6, and CNGC9 demonstrated that calcium-dependent protein kinase 1 (CPK1) directly activates these channels by phosphorylating specific serine residues (Ser20, Ser27, and Ser26, respectively) . This phosphorylation is essential for establishing cytosolic Ca²⁺ gradients in growing root hairs.

Additionally, OsCNGC9 (in rice) is phosphorylated by OsRLCK185, which increases cytosolic Ca²⁺ concentration . Given that CNGC13 is involved in heavy metal transport, kinases involved in abiotic stress responses would be prime candidates to investigate.

A comprehensive understanding of CNGC13 phosphorylation would reveal important aspects of its regulation in response to specific environmental stimuli, particularly heavy metal exposure.

How does CNGC13 contribute to the specificity of calcium signatures in response to different stimuli?

CNGC13's potential role in generating specific calcium signatures represents an advanced research question:

Conceptual Framework:
CNGCs contribute to stimulus-specific Ca²⁺ signatures (transient increases in cytosolic Ca²⁺) that trigger appropriate cellular responses. The specificity of these signatures depends on:

  • Spatial localization of channels

  • Temporal activation patterns

  • Amplitude and duration of Ca²⁺ influx

  • Interaction with other Ca²⁺ transporters

Experimental Approaches:

  • Real-time Ca²⁺ Imaging:

    • Express genetically encoded Ca²⁺ indicators (GCaMP6, R-GECO) in wild-type and cngc13 mutant backgrounds

    • Apply relevant stimuli (heavy metals, particularly Pb²⁺)

    • Analyze Ca²⁺ signature parameters: amplitude, duration, oscillation frequency

  • Subcellular Targeting:

    • Use targeted Ca²⁺ sensors to monitor Ca²⁺ in different cellular compartments

    • Determine if CNGC13 contributes to localized Ca²⁺ microdomains

  • Heteromeric Channel Formation:

    • Investigate if CNGC13 forms heteromeric channels with other CNGCs

    • Assess how subunit composition affects Ca²⁺ signature characteristics

Recent research suggests that CNGCs form heterotetrameric complexes with unique functional characteristics compared to homotetramers . For example, CNGC2 and CNGC4 likely form a channel complex , while CNGC7 and CNGC8 interact with CNGC18 to regulate pollen tube growth .

Understanding CNGC13's contribution to Ca²⁺ signature specificity, particularly in response to heavy metals, would provide significant insights into its physiological role and potential applications in phytoremediation.

What molecular mechanisms explain CNGC13's apparent specificity for lead (Pb²⁺) transport?

Understanding the molecular basis of CNGC13's role in Pb²⁺ transport requires sophisticated experimental approaches:

Structural Approaches:

  • Molecular Modeling:

    • Homology modeling of CNGC13 pore region

    • Molecular docking simulations with Pb²⁺ and other ions

    • Molecular dynamics to assess ion permeation pathways

  • Structure-Function Analysis:

    • Mutagenesis of predicted selectivity filter residues

    • Chimeric approaches swapping pore regions with other CNGCs

    • Electrophysiological characterization of mutants

Biophysical Approaches:

  • Ion Selectivity Measurements:

    • Bi-ionic potential measurements

    • Competition experiments with various cations

    • Concentration-dependent permeation studies

  • Direct Metal Binding Assays:

    • Isothermal titration calorimetry with purified channel

    • Fluorescence-based metal binding assays

    • Mass spectrometry to identify metal-binding sites

Cellular and Physiological Approaches:

  • Metal Accumulation Studies:

    • Use radioactive tracers or ICP-MS to quantify Pb²⁺ uptake

    • Compare wild-type, cngc13 knockout, and complemented lines

    • Analyze subcellular metal distribution

Understanding the molecular determinants of CNGC13's selectivity for Pb²⁺ could provide valuable insights for designing channels with modified selectivity for phytoremediation applications. This knowledge would also contribute to our fundamental understanding of ion channel selectivity mechanisms.

How does the formation of heteromeric channels impact CNGC13 function, and what techniques best reveal these interactions?

Investigating CNGC13's potential to form heteromeric channels requires sophisticated approaches:

Protein-Protein Interaction Methods:

  • In Planta Approaches:

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Co-immunoprecipitation from plant tissues

    • Proximity labeling techniques (BioID, TurboID)

  • Biochemical Approaches:

    • Blue native PAGE to resolve intact complexes

    • Chemical crosslinking followed by mass spectrometry

    • Size exclusion chromatography with multi-angle light scattering

Functional Characterization:

  • Co-expression Studies:

    • Electrophysiological analysis of co-expressed subunits

    • Calcium imaging with defined subunit combinations

    • Dominant-negative approaches to disrupt heterotetramers

  • Single-Molecule Techniques:

    • Single-molecule pull-down assays

    • Total internal reflection fluorescence microscopy

    • Subunit counting approaches

Recent Insights:
Studies have revealed that CNGC subunits can form heterotetrameric complexes with unique functional properties. For example:

  • CNGC2 and CNGC4 likely form a heteromeric channel complex

  • CNGC7 and CNGC8 interact with CNGC18 to regulate pollen tube growth

  • CNGC heteromeric complexes may exhibit functional properties distinct from those of their constituent homomeric channels

Given CNGC13's specialized role in Pb²⁺ transport, it's crucial to determine if it forms heteromers with other Group I CNGCs (CNGC1, CNGC3, CNGC10) that are also implicated in heavy metal transport. Such heteromerization could explain functional specialization and provide mechanisms for conditional regulation of heavy metal uptake.

What is the three-dimensional structure of CNGC13, and how does it inform our understanding of function?

Elucidating CNGC13's structure represents a significant challenge and opportunity:

Structural Determination Approaches:

  • Cryo-Electron Microscopy:

    • Most promising approach for membrane protein structure

    • Requires high-level expression and purification

    • Consider nanodiscs or amphipols to maintain native conformation

  • X-ray Crystallography:

    • Challenging for membrane proteins but has been successful for some channels

    • Consider LCP (lipidic cubic phase) crystallization

    • Generate well-diffracting crystals through systematic screening

  • NMR Spectroscopy:

    • Suitable for isolated domains (CNBD, CaM-binding domain)

    • Could provide dynamic information about regulatory mechanisms

Complementary Approaches:

  • Homology Modeling:

    • Based on structures of related channels

    • Validate through mutagenesis and functional studies

  • Molecular Dynamics Simulations:

    • Investigate ion permeation pathways

    • Study conformational changes upon ligand binding

    • Predict effects of mutations

Key Structural Features to Resolve:

  • Selectivity filter architecture determining Pb²⁺ specificity

  • Cyclic nucleotide binding domain conformation

  • Calmodulin binding interface

  • Quaternary structure and subunit arrangement

  • Conformational changes associated with gating

While no CNGC13 structure is currently available, structural insights would revolutionize our understanding of its function and regulation. Such information would enable structure-guided approaches to engineer plants with enhanced phytoremediation capabilities for heavy metal contamination.

How can CNGC13 research contribute to developing plants with enhanced heavy metal remediation capabilities?

CNGC13's involvement in Pb²⁺ transport positions it as a potential target for phytoremediation applications:

Research Strategies:

  • Channel Engineering:

    • Modify selectivity filter to enhance transport of specific heavy metals

    • Alter regulatory domains to increase constitutive activity

    • Design synthetic promoters for controlled expression

  • Transgenic Approaches:

    • Overexpress engineered CNGC13 in high-biomass plants

    • Target expression to specific tissues (roots, shoots)

    • Combine with metal chelators or sequestration mechanisms

  • Field Testing Methodologies:

    • Design appropriate field trials with proper controls

    • Develop monitoring protocols for metal uptake efficiency

    • Assess environmental impact and biosafety

Practical Considerations:

  • Balance metal uptake with plant viability

  • Evaluate potential for biomagnification in food chains

  • Consider biocontainment strategies for transgenic plants

Future Directions:
Comprehensive understanding of CNGC13's structure-function relationship would enable rational design of variants with enhanced heavy metal transport capabilities. Combined with appropriate expression systems, this could lead to effective phytoremediation strategies for contaminated soils.

Additionally, CNGC13 research could inform the development of biosensors for heavy metal detection, providing valuable tools for environmental monitoring.

How does CNGC13 function integrate with the broader calcium signaling network in plants?

Understanding CNGC13's role in the calcium signaling network requires systems-level approaches:

Experimental Strategies:

  • Network Mapping:

    • Phosphoproteomic analysis following CNGC13 activation

    • Transcriptomic profiling of wild-type vs. cngc13 mutants

    • Protein interaction network determination

    • Genetic interaction screens

  • Calcium Signaling Integration:

    • Identify calcium-dependent proteins affected by CNGC13 function

    • Map relationships with calcium-dependent protein kinases (CPKs)

    • Determine interactions with calcineurin B-like proteins (CBLs) and CBL-interacting protein kinases (CIPKs)

  • Multi-Omics Approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Construct predictive models of CNGC13's role in calcium signaling

    • Validate through targeted experiments

Current Knowledge Gaps:
While CNGC13 is implicated in heavy metal transport, its precise role in calcium signaling remains poorly characterized. Other CNGCs have well-established roles in generating calcium signatures in response to specific stimuli. For example:

  • CNGC2 is required for extracellular ATP-induced calcium influx

  • CNGC5/6/9 establish calcium gradients essential for root hair growth

Determining whether CNGC13 contributes to specific calcium signatures in response to heavy metal exposure would significantly advance our understanding of its physiological role and potential applications.

What evolutionary insights can be gained from comparative analysis of CNGC13 across plant species?

Evolutionary analysis of CNGC13 can provide valuable insights into its function and adaptation:

Research Approaches:

  • Phylogenetic Analysis:

    • Construct comprehensive phylogenies of Group I CNGCs across plant species

    • Identify orthologous relationships and evolutionary patterns

    • Analyze selective pressure on different protein domains

  • Comparative Genomics:

    • Investigate gene synteny and duplication events

    • Analyze promoter evolution and regulatory divergence

    • Compare exon-intron structure across species

  • Functional Conservation Testing:

    • Express CNGC13 orthologs from different species in Arabidopsis cngc13 mutants

    • Compare heavy metal transport capabilities

    • Identify conserved and divergent functional properties

Evolutionary Patterns in CNGCs:
The CNGC family has undergone significant expansion in plants. For example:

  • Arabidopsis has 20 CNGC genes

  • Rice has 16 CNGCs

  • Wheat has 47 CNGCs

  • Citrus clementina has 33 CNGCs

This expansion suggests functional diversification, with certain CNGCs potentially evolving specialized roles. Comparative analysis could reveal whether CNGC13's role in heavy metal transport is ancestral or derived, and identify species with potentially enhanced heavy metal transport capabilities.

Such evolutionary insights could guide the selection of plant species for phytoremediation applications and inform strategies for engineering improved heavy metal transport in crop plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.