Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 15 (CNGC15)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Physiology

CNGC15 exhibits dual roles in calcium signaling and nitrate response, with subcellular localization dependent on developmental stage:

Nuclear Calcium Signaling

  • Mediates nuclear calcium release in root apical meristem cells, essential for root development in young seedlings .

  • Interacts with AtDMI1 at the nuclear envelope to regulate auxin homeostasis .

Nitrate Signaling

  • Relocalizes to the plasma membrane in older roots to form a complex with nitrate transceptor NRT1.1 .

  • Modulates nitrate-induced expression of LBD37, LBD38, and LBD39 genes, which regulate lateral root development .

Mutant Allele Studies

A novel mutant allele (Atcngc15-D427N) with a conserved aspartic acid mutation (D427N) in the C-linker domain shows:

  • Impaired channel gating, leading to reduced nuclear calcium flux .

  • Shortened root apical meristem and disrupted LBD39 induction under nitrate treatment .

Subcellular Dynamics

  • Early development (6 days): Localizes to the nuclear envelope .

  • Later stages (12 days): Translocates to the plasma membrane in columella cells under nitrate exposure .

Interaction Network

Interacting PartnerFunctionReference
NRT1.1Nitrate sensing and transport
AtDMI1Nuclear calcium oscillations
CPK10/30/32Calcium-dependent kinase signaling

Mechanistic Studies

  • Used to dissect calcium signaling pathways in root development and nitrate responses .

  • Serves as a model for studying CNGC channel gating mechanisms .

Agricultural Potential

  • Autoactive CNGC15 variants (e.g., gain-of-function alleles) enhance symbiosis with nitrogen-fixing bacteria and arbuscular mycorrhizal fungi in Medicago truncatula and wheat .

  • Increases flavonoid production, promoting nutrient acquisition and stress resilience .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CNGC15; At2g28260; T3B23.7; Putative cyclic nucleotide-gated ion channel 15; Cyclic nucleotide- and calmodulin-regulated ion channel 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-678
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CNGC15
Target Protein Sequence
MGYGNSRSVRFQEDQEVVHGGESGVKLKFKINGTQINNVKMMSKGKFLKAKVLSRVFSED LERVKTKILDPRGQTIRRWNKIFLIACLVSLFVDPLFFFLPVMRNEACITIGVRLEVVLT LIRSLADAFYIAQILIRFRTAYIAPPSRVFGRGELVIDSRKIAWRYLHKSFWIHLVAALP LPQVLIWIIIPNLRGSPMTNTKNVLRFIIIFQYVPRMFLIFPLSRQIIKATGVVTETAWA GAAYNLMLYMLASHVLGACWYLLAVERQEACWRHACNIEKQICQYRFFECRRLEDPQRNS WFEWSNITTICKPASKFYEFGIFGDAVTSTVTSSKFINKYFYCLWWGLKNLSSLGQNLAT STYAGEILFAIIIATLGLVLFALLIGNMQTYLQSTTMRLEEWRIRRTDTEQWMHHRQLPP ELRQAVRKYDQYKWLATRGVDEEALLISLPLDLRRDIKRHLCFDLVRRVPLFDQMDERML DAICERLKPALCTEGTFLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCLIGPGDFC GEELLTWALDPRPVVILPSSTRTVKAICEVEAFALKAEDLQFVASQFRRLHTKQLRHKFR FYSHQWRTWAACFIQAAWRRHRKRKYKTELRAKEEFHYRFEAATARLAVNGGKYTRSGSD SGMMSSIQKPVEPDFSSE
Uniprot No.

Target Background

Function
Putative cyclic nucleotide-gated ion channel.
Database Links

KEGG: ath:AT2G28260

STRING: 3702.AT2G28260.1

UniGene: At.52949

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.