Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 18 (CNGC18)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 18 (CNGC18) is a laboratory-produced version of the native CNGC18 protein, which belongs to the cyclic nucleotide-gated channel family in plants. The recombinant form is typically produced by expressing the CNGC18 gene in a host organism such as Escherichia coli, allowing researchers to obtain purified protein for various studies and applications . This protein production method enables scientists to study the protein's structure and function in controlled laboratory settings, providing insights that might be difficult to obtain from the native protein in its biological context.

The native CNGC18 is a membrane protein that functions as a calcium-permeable channel in Arabidopsis. It is particularly important in reproductive processes, specifically in pollen tube growth and guidance to ovules during fertilization . The ability to produce and study this protein in a recombinant form has significantly advanced our understanding of its critical biological roles.

CNGC Family Context

CNGC18 is one member of a larger family of cyclic nucleotide-gated channels in Arabidopsis thaliana. The Arabidopsis genome contains 20 CNGC genes encoding putative non-selective ion channels . These channels play diverse roles in plant physiology, including defense responses, heavy metal and cation transport, and reproductive processes. The study of individual members of this family, such as CNGC18, contributes to our broader understanding of how these channels function collectively in plant biology and how their specific roles have evolved.

Role in Pollen Tube Growth and Guidance

CNGC18 plays a critical role in plant reproduction, specifically in pollen tube growth and guidance to ovules for fertilization. Research has established that CNGC18 functions as the main calcium channel in pollen tube tips for pollen tube guidance to ovules by regulating external calcium influx in Arabidopsis . This function is essential for the precise navigation of pollen tubes through the female reproductive tissues to reach the ovules.

Studies have shown that mutations in CNGC18 result in severe defects in pollen tube growth, including:

  • Reduced pollen germination percentages

  • Increased percentages of ruptured pollen grains and tubes

  • Formation of branched pollen tubes

  • Pollen tubes that are kinky, short, and often thin

  • Inability of pollen tubes to grow into the transmitting tract

These defects ultimately lead to male sterility in Arabidopsis thaliana, highlighting the essential nature of CNGC18 in plant reproduction . The severity of the reproductive defects underscores the critical role of this calcium channel in ensuring proper pollen function.

Function as a Calcium Channel

CNGC18 functions as a calcium permeable channel that mediates the influx of external calcium into the pollen tube tip . This calcium influx is crucial for establishing and maintaining the calcium gradient in the pollen tube tip, which is essential for directional growth and guidance. The calcium gradient acts as an internal compass for the growing pollen tube, directing it toward the ovules.

Heterologous expression of CNGC18 in Escherichia coli resulted in a time- and concentration-dependent accumulation of more calcium, providing direct evidence for its function as a calcium channel . This experimental approach has been valuable in confirming the channel's ion transport capabilities outside its native context.

CNGC18 provides a mechanism to directly transduce a cyclic nucleotide (cNMP) signal into an ion flux that can produce a localized signal capable of regulating the pollen tip-growth machinery . This signal transduction mechanism represents a fascinating example of how plants coordinate molecular signals to achieve precise cellular behaviors during reproduction.

Localization in the Plasma Membrane

CNGC18 is asymmetrically localized to the plasma membrane at the growing tip of the pollen tube . This specific localization is critical for its function in regulating the directional growth of pollen tubes. The concentration of the channel at the growing tip allows for localized calcium influx exactly where it's needed to guide growth.

Expression of a GFP-tagged CNGC18 in mutant pollen has provided evidence for this asymmetric localization to the plasma membrane at the growing tip, starting at the time of pollen grain germination . This visualization approach has been instrumental in understanding how the channel's spatial distribution contributes to its biological function.

Key Research Findings

Several key findings about CNGC18 have emerged from recent research:

  1. CNGC18 is the main calcium channel in pollen tube tips essential for pollen tube guidance to ovules in Arabidopsis .

  2. Reduction of external calcium concentration from 10 mM to 5 mM, and further to 2 mM, leads to decreased pollen germination percentages and increased percentages of ruptured pollen grains and tubes, and branched pollen tubes in CNGC18 mutants compared with wild type .

  3. Point mutations in CNGC18 (R491Q or R578K) result in abnormal calcium gradients, leading to strong pollen tube guidance defects and severe male sterility by impairing activation by upstream activators .

  4. The transmembrane domains of CNGC18 are essential for pollen tube guidance to ovules .

  5. Out of eight calcium channels present in pollen tubes, CNGC18 plays the most vital role in pollen tube guidance in Arabidopsis .

These findings collectively highlight the essential and specific role of CNGC18 in pollen function and plant reproduction. The research demonstrates both the biological importance of this channel and the molecular mechanisms through which it operates.

Mutation Studies and Their Effects

Research on CNGC18 has utilized various mutant alleles to understand its function:

Mutant AlleleMutation TypePhenotypic Effects
CNGC18-17Point mutation (R491Q)Reduced pollen germination, increased ruptured pollen grains and tubes, branched pollen tubes, pollen tube guidance defects
CNGC18-22Point mutationReduced pollen germination, increased ruptured pollen tubes
CNGC18-1Null mutationMale sterility, defects in pollen tube growth

These mutation studies have provided strong genetic evidence for the essential role of CNGC18 in pollen tube growth and guidance. The specific phenotypes associated with different mutations have helped researchers understand the relationship between the protein's structure and its function, as well as the consequences of its dysfunction for plant reproduction.

Importance in Plant Reproduction

The research findings collectively demonstrate that CNGC18 is essential for plant reproduction, particularly for the successful navigation of pollen tubes to ovules for fertilization. The male sterility observed in CNGC18 null mutations underscores the critical nature of this protein in the plant life cycle . Without functional CNGC18, plants cannot effectively reproduce through pollination, highlighting the evolutionary importance of this calcium channel.

CNGC18 represents an example of a cyclic nucleotide-gated channel that is essential to an organism's life cycle, raising the possibility that cyclic nucleotide-gated channels have a widespread role in regulating cell-growth dynamics in both plants and animals . This connection between cyclic nucleotide signaling, ion channel function, and polarized cell growth represents an important area for comparative biology research.

Recombinant Protein Applications

The recombinant CNGC18 protein has several potential applications in research:

  1. Structural studies to understand the molecular mechanisms of cyclic nucleotide-gated channels

  2. Biochemical assays to investigate ion transport properties

  3. Development and validation of compounds that might modulate cyclic nucleotide-gated channel activity

  4. Generation of antibodies for detection and localization studies

  5. In vitro reconstitution systems to study channel activity

These applications enable researchers to investigate various aspects of CNGC18 function in controlled laboratory settings, providing insights that complement in vivo studies. The availability of purified recombinant protein facilitates research approaches that would be difficult or impossible with the native protein in its cellular context.

Antibodies and Other Research Tools

Several research tools have been developed for studying CNGC18:

  1. Antibodies: Rabbit polyclonal antibodies against CNGC18 are commercially available. These antibodies recognize the C-terminal section of the protein and can be used for Western blotting and potentially other immunological techniques .

Antibody SpecificationDetails
Catalog NumberPHY7648S
TypeRabbit polyclonal antibody
ImmunogenKLH-conjugated synthetic peptide (18 aa from C terminal section)
FormLyophilized
Quantity150 μg
ApplicationsWestern Blot (1:1000-1:2000)
Expected/apparent MW80 kDa
  1. GFP-tagged CNGC18: Fluorescently tagged versions of CNGC18 have been used to visualize its localization in pollen tubes .

  2. Promoter::GUS reporter: This has been used to analyze the expression pattern of CNGC18, confirming that it is expressed primarily in pollen .

  3. Mutant alleles: Various mutant alleles of CNGC18 have been generated and characterized, providing valuable tools for understanding its function .

These research tools collectively provide a comprehensive toolkit for investigating CNGC18 function from multiple angles, from its expression pattern to its subcellular localization and functional properties. The availability of these tools has been instrumental in advancing our understanding of this important calcium channel.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
CNGC18; At5g14870; T9L3_170; Cyclic nucleotide-gated ion channel 18; Cyclic nucleotide- and calmodulin-regulated ion channel 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CNGC18
Target Protein Sequence
MNKIRSLRCLLPETITSASTAASNRGSDGSQFSVLWRHQILDPDSNIVTYWNHVFLITSI LALFLDPFYFYVPYVGGPACLSIDISLAATVTFFRTVADIFHLLHIFMKFRTAFVARSSR VFGRGELVMDSREIAMRYLKTDFLIDVAAMLPLPQLVIWLVIPAATNGTANHANSTLALI VLVQYIPRSFIIFPLNQRIIKTTGFIAKTAWAGAAYNLLLYILASHVLGAMWYLSSIGRQ FSCWSNVCKKDNALRVLDCLPSFLDCKSLEQPERQYWQNVTQVLSHCDATSSTTNFKFGM FAEAFTTQVATTDFVSKYLYCLWWGLRNLSSYGQNITTSVYLGETLFCITICIFGLILFT LLIGNMQSSLQSMSVRVEEWRVKRRDTEEWMRHRQLPPELQERVRRFVQYKWLATRGVDE ESILHSLPTDLRREIQRHLCLSLVRRVPFFSQMDDQLLDAICGCLVSSLSTAGTYIFREG DPVNEMLFVIRGQIESSTTNGGRSGFFNSTTLRPGDFCGEELLTWALMPNSTLNLPSSTR SVRALSEVEAFALSAEDLKFVAHQFKRLQSKKLQHAFRYYSHQWRAWGACFVQSAWRRYK RRKLAKELSLHESSGYYYPDETGYNEEDEETREYYYGSDEEGGSMDNTNLGATILASKFA ANTRRGTNQKASSSSTGKKDGSSTSLKMPQLFKPDEPDFSIDKEDV
Uniprot No.

Target Background

Function
Cyclic nucleotide-gated ion channel essential for directional pollen tube growth within the transmitting tract. Functions as a Ca(2+)-permeable divalent cation-selective channel inhibited by lanthanum or gadolinium. Regulated by CPK32, it mediates Ca(2+) transport across the plasma membrane in response to Ca(2+) oscillations.
Gene References Into Functions
  1. Data indicate that CNGC18 plays crucial roles in pollen germination and tube growth as a Ca(2+) channel in Arabidopsis. PMID: 27322818
  2. Among 8 Ca(2+) channels, CNGC18 was the only one essential for pollen tube guidance. Its transmembrane domains are necessary for this function. Point mutations R491Q or R578K resulted in abnormal Ca(2+) gradients and significant pollen tube guidance defects. PMID: 26929345
  3. Arabidopsis CNGC18 is a Ca(2)-permeable channel. PMID: 24380879
  4. CNGCs have a widespread role in regulating cell-growth dynamics in both plant and animal systems. PMID: 17726111
Database Links

KEGG: ath:AT5G14870

STRING: 3702.AT5G14870.1

UniGene: At.31874

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in pollen grains. Not detected in leaves, roots or root hairs.

Q&A

What is CNGC18 and what is its functional significance in Arabidopsis thaliana?

CNGC18 is a member of the cyclic nucleotide-gated channel family in Arabidopsis thaliana, functioning as an essential Ca²⁺ channel primarily expressed in pollen. Its critical importance lies in regulating polarized tip growth of pollen tubes and mediating pollen tube guidance toward ovules for double fertilization. Genetic evidence has conclusively demonstrated that CNGC18 provides a mechanism to directly transduce cyclic nucleotide (cNMP) signals into ion fluxes, producing localized signals capable of regulating the pollen tip-growth machinery . Studies of null mutations in CNGC18 have revealed that this channel is indispensable for male fertility, as its absence results in sterility due to defective pollen tube growth . Among the eight calcium channels expressed in pollen (including six CNGCs and two glutamate receptor-like channels), CNGC18 has been identified as the only one essential for pollen tube guidance .

How does CNGC18 contribute to calcium gradients in pollen tubes?

CNGC18 functions as the main Ca²⁺ channel in pollen tube tips responsible for establishing and maintaining the cytosolic Ca²⁺ gradient necessary for proper pollen tube growth and orientation. This gradient is formed through CNGC18-mediated external Ca²⁺ influx at the growing pollen tube tip . Experimental evidence demonstrates that point mutations in CNGC18 (R491Q or R578K) result in abnormal Ca²⁺ gradients, which directly correlate with strong pollen tube guidance defects . The channel is asymmetrically localized to the plasma membrane at the growing tip, starting at the time of pollen grain germination, which allows for the spatially controlled calcium influx required for directional growth . The maintenance of this calcium gradient is particularly sensitive to external calcium concentration, with reduced external Ca²⁺ concentrations leading to increased percentages of ruptured pollen grains, tubes, and abnormal branched pollen tubes in CNGC18 mutants .

What distinguishes CNGC18 from other calcium channels in pollen?

Among the eight calcium-permeable channels expressed in Arabidopsis pollen (including six CNGCs and two glutamate receptor-like channels), CNGC18 has unique properties and functions. While other channels such as CNGC7 and CNGC8 also contribute to pollen function, CNGC18 is specifically essential for pollen tube guidance . Research has shown that CNGC7 and CNGC8 function redundantly, requiring mutation of both genes to observe male sterility, whereas single mutations in CNGC18 are sufficient to cause significant defects in pollen tube growth and guidance . Additionally, while CNGC7 and CNGC8 are critical during the initiation of pollen tube growth (with double mutants showing high rates of pollen bursting), CNGC18 appears essential throughout the process of pollen tube elongation and directed growth toward ovules . Protein localization studies further distinguish these channels, with CNGC18 predominantly localized to the plasma membrane at the growing tip, while GFP-tagged CNGC7 shows strongest localization to the flanks of the pollen tube tip .

What domains of CNGC18 are critical for its function in pollen tube guidance?

Domain-swapping experiments have definitively shown that CNGC18's transmembrane domains are indispensable for proper pollen tube guidance . These domains likely form the ion-conducting pore through which calcium ions pass. Additionally, research has identified specific amino acid residues that are critical for CNGC18 function. Point mutations R491Q (in cngc18-17) or R578K (in cngc18-22) result in impaired activation of the channel, leading to abnormal Ca²⁺ gradients and pollen tube guidance defects . Furthermore, studies of related CNGCs (CNGC7 and CNGC8) have identified the junction between the putative cyclic nucleotide binding-site and the calmodulin binding-site as important for proper functioning. Specifically, an F to W substitution (F589W in CNGC7 and F624W in CNGC8) at this junction significantly reduced the rescue efficiency of these channels in corresponding mutants . While not directly demonstrated for CNGC18, the high conservation of these domains across the CNGC family suggests similar structural importance for CNGC18 function.

What is the subcellular localization of CNGC18 and how does it relate to its function?

CNGC18 exhibits a highly specific subcellular localization pattern that directly correlates with its function in regulating polarized tip growth. GFP-tagged CNGC18 localizes asymmetrically to the plasma membrane at the growing tip of pollen tubes, beginning at the time of pollen grain germination . This specific localization allows CNGC18 to regulate localized calcium influx at the growing tip, facilitating the formation of the calcium gradient necessary for directional growth. The polarized distribution of CNGC18 differs from that of other pollen CNGCs; for example, GFP-tagged CNGC7 preferentially localizes to the plasma membrane at the flanks of the growing tip rather than at the apex itself . This differential localization pattern among pollen CNGCs suggests a complex spatial organization of calcium signaling machinery that enables precise regulation of pollen tube growth. The maintenance of this asymmetric distribution of CNGC18 is likely regulated by the dynamic pollen tube cytoskeleton and membrane recycling processes, though the exact mechanisms controlling CNGC18 targeting to the tip remain to be fully elucidated.

What methods are used to generate and characterize CNGC18 mutants?

Researchers employ several complementary approaches to generate and characterize CNGC18 mutants. The primary method for generating loss-of-function mutations involves identifying T-DNA insertion lines from repositories such as the Syngenta Arabidopsis Insertion Library (SAIL) and the SALK collection . These insertions typically disrupt gene function by inserting large DNA fragments into coding or regulatory regions. For CNGC18, two null mutations have been characterized that result in male sterility . Point mutations in CNGC18, such as the R491Q mutation in cngc18-17 and R578K mutation in cngc18-22, provide valuable tools for studying specific domain functions without completely abolishing protein expression .

Mutant characterization typically involves a combination of:

  • PCR-based genotyping using gene-specific and T-DNA border primers to confirm insertion positions

  • Segregation analysis to evaluate transmission efficiencies of mutations

  • In vitro pollen germination assays to assess pollen tube growth defects

  • Semi-in vivo pollen tube growth assays using stigma surfaces

  • Live calcium imaging to visualize calcium gradient formation

  • Complementation tests using wild-type or modified CNGC18 transgenes to confirm the causality of mutations

These approaches collectively provide rigorous evidence for CNGC18 function and the specific roles of different protein domains .

What techniques are used to study CNGC18-mediated calcium influx?

Several specialized techniques are employed to study CNGC18-mediated calcium influx in pollen tubes:

How can recombinant CNGC18 be produced for functional studies?

Production of recombinant CNGC18 for functional studies involves several approaches that must address the challenges inherent in membrane protein expression:

  • Heterologous expression systems: E. coli has been successfully used for functional expression of CNGC18, allowing for calcium accumulation studies . Other potential systems include yeast, insect cells, or mammalian cell lines, which may provide environments more conducive to proper folding of plant membrane proteins.

  • Fusion proteins for detection and purification: CNGC18 has been successfully tagged with GFP for localization studies without compromising function, as demonstrated by the ability of GFP-CNGC18 to complement cngc18 mutant phenotypes . This suggests that N-terminal tags are tolerated and can be used for purification and detection purposes.

  • Domain expression: For structural studies or antibody production, expression of specific domains (e.g., the cyclic nucleotide binding domain) rather than the full-length protein may improve yield and solubility.

  • Reconstitution in liposomes: Although not explicitly mentioned in the search results, reconstitution of purified recombinant CNGC18 into liposomes could provide a controlled system for studying channel activity in response to various stimuli.

  • Structure-function studies: Site-directed mutagenesis of recombinant CNGC18 can be used to assess the importance of specific residues, as demonstrated by the analysis of R491Q and R578K mutations .

How do CNGC18 and other CNGCs cooperate in pollen tube growth regulation?

The regulation of pollen tube growth involves a complex interplay between multiple CNGCs with distinct but complementary functions. CNGC18 is essential for pollen tube guidance throughout the growth process, while CNGC7 and CNGC8 function redundantly and are particularly critical during the initiation of pollen tube growth . This functional specialization is reflected in their different localization patterns: CNGC18 localizes to the plasma membrane at the growing tip apex, while CNGC7 shows stronger localization to the flanks of the tip .

The temporal coordination of these channels likely involves:

  • Initiation phase: CNGC7 and CNGC8 are critical during pollen germination and the initial stages of tube emergence, as evidenced by the high frequency of bursting in cngc7/8 double mutants .

  • Elongation phase: CNGC18 becomes increasingly important during sustained tube growth, maintaining the calcium gradient necessary for continued polarized growth .

  • Guidance phase: CNGC18 is specifically required for proper response to guidance cues from female tissues, as cngc18 mutants show defective guidance even when able to form tubes .

This cooperative system allows for precise regulation of calcium dynamics throughout the different phases of pollen tube growth, with specific channels being activated in response to different signals at appropriate times and locations .

What signaling pathways regulate CNGC18 activity during pollen tube growth?

While the search results don't provide comprehensive details about all signaling pathways regulating CNGC18, several important insights can be extracted:

  • Cyclic nucleotide signaling: As a cyclic nucleotide-gated channel, CNGC18 is regulated by cyclic nucleotide monophosphates (cNMPs), which can trigger growth-altering Ca²⁺ signals. This provides a direct mechanism for transducing cNMP signals into calcium fluxes that regulate pollen tube growth .

  • Female tissue-derived attractants: Multiple attractants from female gametophytes guide pollen tube growth, potentially by regulating the activity of calcium channels including CNGC18 . These attractants likely bind to specific receptors that ultimately modulate CNGC18 activity.

  • Calmodulin regulation: The presence of a calmodulin binding site in CNGCs suggests that calcium-calmodulin complexes may provide feedback regulation of channel activity . This would allow for fine-tuning of calcium influx based on existing cytosolic calcium levels.

  • Potential phosphorylation: While not explicitly mentioned in the search results, many ion channels are regulated by phosphorylation. The identification of critical residues like R491 and R578 suggests potential regulatory sites that might be modulated by kinases in response to various signals .

What are the current challenges in studying CNGC18 function and how might they be addressed?

Current challenges in CNGC18 research include:

  • Functional redundancy: While CNGC18 has a non-redundant role in pollen tube guidance, there may be partial functional overlap with other calcium channels that complicates interpretation of some phenotypes .

    Potential solution: Generate higher-order mutants combining cngc18 with mutations in related channels to fully dissect the contribution of each channel to pollen function.

  • Technical limitations in measuring calcium dynamics: Real-time visualization of calcium gradients at high spatial and temporal resolution remains challenging.

    Potential solution: Employ advanced imaging techniques such as light sheet microscopy combined with improved genetically encoded calcium indicators specifically targeted to different subcellular compartments.

  • Heterologous expression challenges: Membrane proteins like CNGC18 are often difficult to express in functional form in heterologous systems.

    Potential solution: Explore alternative expression systems or develop pollen protoplast patch-clamp approaches to study the channel in its native membrane environment.

  • Limited structural information: The absence of crystal structures for plant CNGCs limits understanding of their gating mechanisms.

    Potential solution: Apply cryo-electron microscopy or homology modeling based on related channels with known structures to predict CNGC18 structure.

  • Complex in vivo regulation: The multiple factors regulating CNGC18 in vivo make it difficult to isolate individual regulatory pathways.

    Potential solution: Develop reconstituted systems where individual components can be added sequentially to identify specific regulatory interactions.

How do CNGC18 mutations affect pollen phenotypes compared to other pollen-expressed CNGCs?

The phenotypic consequences of mutations in CNGC18 differ significantly from those observed in other pollen-expressed CNGCs:

Channel(s)Mutation TypePollen PhenotypesFertility ImpactReference
CNGC18Null mutationsTubes kinky, short, thin, unable to enter transmitting tractComplete male sterility
CNGC18Point mutations (R491Q, R578K)Abnormal Ca²⁺ gradients, guidance defectsReduced fertility
CNGC7 or CNGC8Single gene knockoutNo observable defectNormal fertility
CNGC7 and CNGC8Double knockoutHigh frequency of bursting during germinationComplete male sterility (>3000-fold reduction)

This comparison reveals that:

  • CNGC18 has a non-redundant role that cannot be compensated by other channels, as single gene mutations cause severe phenotypes .

  • CNGC7 and CNGC8 have redundant functions, requiring mutation of both genes to observe defects .

  • The timing of defects differs, with cngc7/8 mutants failing at the initiation of germination (bursting), while cngc18 mutants can initiate tubes but show defects in sustained growth and guidance .

  • Point mutations in CNGC18 can separate different aspects of channel function, affecting guidance while still allowing some tube growth .

These differences highlight the specialized roles of different CNGCs in the complex process of pollen germination and tube growth.

What evolutionary insights can be gained from studying CNGC18 across plant species?

While the search results don't provide direct comparative information across species, several evolutionary insights can be inferred:

  • The essential role of CNGC18 in the reproductive process of Arabidopsis suggests it may be conserved in other flowering plants that rely on pollen tube growth for fertilization. This conservation would be expected due to strong selective pressure to maintain fertility mechanisms.

  • The specialized subcellular localization and function of CNGC18 compared to other pollen CNGCs suggests evolutionary diversification within the CNGC family to handle distinct aspects of the same biological process .

  • The presence of 20 CNGC genes in Arabidopsis, with 6 expressed in pollen, indicates substantial gene family expansion, likely allowing for increasing specialization of channel functions in different tissues and developmental contexts .

  • The identification of specific residues critical for CNGC18 function (R491, R578) provides potential targets for comparative analysis across species to identify conserved regulatory mechanisms .

  • The finding that CNGC18 is essential for responding to female tissue-derived guidance cues suggests co-evolution between male and female reproductive structures, with the pollen calcium signaling system evolving to recognize species-specific attractants .

What future research directions could advance our understanding of CNGC18 function?

Several promising research directions could significantly advance our understanding of CNGC18:

  • Structural biology approaches: Determining the three-dimensional structure of CNGC18 would provide invaluable insights into its gating mechanism, ion selectivity, and how mutations like R491Q and R578K affect channel function.

  • Identification of direct regulators: Screening for proteins that directly interact with CNGC18 could reveal how its activity is regulated in response to guidance cues from female tissues.

  • Systems biology approach: Comprehensive analysis of the calcium signaling network in pollen, including all channels, pumps, and downstream effectors, could place CNGC18 function in a broader context.

  • Single-cell transcriptomics and proteomics: Analysis of gene expression and protein abundance changes in wild-type versus cngc18 mutant pollen could identify compensatory mechanisms and downstream effects.

  • In vivo imaging of CNGC18 dynamics: Development of advanced imaging techniques to track CNGC18 localization and dynamics during pollen tube growth in real-time could reveal how its distribution changes in response to guidance cues.

  • Computational modeling: Integration of experimental data into mathematical models of pollen tube growth could help predict how changes in CNGC18 activity affect calcium gradients and growth patterns.

  • Translation to crop species: Investigating CNGC18 orthologs in important crop species could potentially lead to applications in breeding or biotechnology to improve pollination efficiency and seed set.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.