Recombinant Arabidopsis thaliana Putative cytochrome c biogenesis ccmF C-terminal-like mitochondrial protein 3 (CCMFN2)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Nomenclature

CCMFN2 is encoded by the ccb203 gene in Arabidopsis thaliana and shares homology with bacterial CcmF proteins involved in heme lyase activity. Key features include:

FeatureDetailsSource
Gene Nameccb203; CCMFN2; CC6BN2
Protein Length203 amino acids (partial)
Subcellular LocationMitochondrial inner membrane (integral protein)
Transmembrane Helices11–13 predicted transmembrane domains
Expression RegionN-terminal His-tagged (1–203)
Purity≥85% (SDS-PAGE)

Key Interactions

CCMFN2 interacts directly with:

Partner ProteinInteraction TypeFunctional RoleSource
CCMFN1Direct (yeast two-hybrid)Stabilizes the heme lyase complex
CCMHDirect (yeast two-hybrid)Coordinates heme transfer to apocytochrome c
Apocytochrome cDirect (affinity pull-down)Substrate recognition and heme attachment

Recombinant Production

CCMFN2 is heterologously expressed in E. coli or yeast systems, yielding functional protein for biochemical studies.

ParameterDetailsSource
Host SystemsE. coli, yeast, baculovirus, mammalian cells
TagN-terminal 10xHis-tag
Storage-20°C/-80°C (lyophilized) or 4°C (working aliquots)

Antibody Development

Polyclonal antibodies against CCMFN2 are used for:

  • ELISA: Quantitative detection in mitochondrial extracts.

  • Western Blot: Validation of protein expression in knockout mutants.

Antibody SpecificityReactivityApplicationsSource
Rabbit Anti-CCMFN2Arabidopsis thalianaELISA, Western blot, immunoprecipitation

Plant-Specific Adaptations

In plants, the bacterial ccmF gene is split into three paralogs (CCMFN1, CCMFN2, CCMFC), likely enabling specialized roles in mitochondrial cytochrome c biogenesis. This contrasts with bacteria, where a single CcmF protein suffices .

Regulatory Mechanisms

  • OXA2a: A mitochondrial insertase required for CCMFN2 membrane insertion and complex assembly .

  • Subfunctionalization: OXA2a and OXA2b in Arabidopsis diverged to handle distinct CcmF proteins, unlike most plants with a single OXA2 homolog .

Critical Role in Heme Ligation

CCMFN2 forms a WWD domain in the intermembrane space, essential for coordinating heme transfer from CCMH to apocytochrome c . Disruption of this complex impairs cytochrome c maturation, affecting mitochondrial electron transport .

Cross-Kingdom Interactions

CCMFN2’s partners include proteins involved in:

  • Programmed Cell Death: Interactions with cytochrome c and DNA damage response factors .

  • Immune Response: Hypothetical links to pathogen resistance via CCMH-mediated signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CCMFN2; CC6BN2; CCB203; AtMg00960; Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 2; Cytochrome c biogenesis orf203; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CCMFN2
Target Protein Sequence
VDTGREQAKRVVRNGKKETTTLPLCWTAGANTVVSDQDQEPIRIWILTCWWFLTVGILLG SWWAYHELGWGGWWFWDPVENASFMPWVLATACIHSVILPFLHSWTLFLNIVTFLCCVLG TFSIRSGLLASVHSFATDDTRGIFLWWFFLLMTGIFMILFYQMKQQASVRRTYKKEMVVA RSTLVHLRHSARAQPRPVMLWKN
Uniprot No.

Target Background

Function
This protein forms a mitochondrial complex with CCMFC, CCMFN1, and CCMH, facilitating the assembly of heme with c-type apocytochromes.
Database Links
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is CCMFN2 and what is its function in Arabidopsis thaliana?

CCMFN2 (also known as ccb203 or CC6BN2) is a putative cytochrome c biogenesis protein found in the mitochondria of Arabidopsis thaliana. It functions as part of the cytochrome c maturation system, which is essential for the biogenesis of c-type cytochromes in plant mitochondria. Unlike mitochondria in fungi and animals that use system III for cytochrome c maturation, plant mitochondria employ system I, which is similar to that found in α- and γ-proteobacteria . CCMFN2 specifically functions in the C-terminal domain of the cytochrome c biogenesis pathway and is encoded as cytochrome c biogenesis orf203 (partial mitochondrion) .

The protein plays a crucial role in the process that requires covalent ligation of the heme cofactor to reduced cysteines of the CXXCH motif of apocytochromes. This process is essential for proper electron transport chain function in mitochondria, making CCMFN2 vital for cellular respiration and energy production in plants . The conservation of this protein across plant species indicates its fundamental importance in plant cellular metabolism.

How is recombinant CCMFN2 typically produced for research purposes?

Recombinant CCMFN2 for research applications can be produced in several expression systems. The most common production methods include:

  • Cell-free expression systems, which allow for rapid protein production without the need for cell culture maintenance .

  • Bacterial expression systems, particularly E. coli, which provide high yields of recombinant protein .

  • Eukaryotic expression systems, including yeast, baculovirus-infected insect cells, or mammalian cells when post-translational modifications are important .

For standard research applications, the recombinant protein is typically produced with a purity of greater than or equal to 85% as determined by SDS-PAGE analysis . The choice of expression system depends on research requirements, with cell-free systems providing rapid results and eukaryotic systems offering more complex post-translational modifications.

What antibodies are available for detecting CCMFN2 in experimental procedures?

Polyclonal antibodies targeting CCMFN2 are commercially available for research applications. Specifically, rabbit anti-Arabidopsis thaliana CCMFN2 polyclonal antibodies have been developed and validated for research use . These antibodies recognize the cytochrome c biogenesis orf203 fragment and are produced through antigen-affinity purification methods.

The available antibodies are primarily of the IgG isotype and have been validated for applications including:

  • Enzyme-Linked Immunosorbent Assay (ELISA)

  • Western Blot (WB)

These immunological tools allow researchers to detect and quantify CCMFN2 in plant tissue samples, facilitating studies on expression patterns, protein localization, and interactions with other components of the cytochrome c biogenesis pathway .

How should I design experiments to study CCMFN2 interaction with other components of the cytochrome c biogenesis pathway?

When designing experiments to study CCMFN2 interactions with other cytochrome c biogenesis components, a systematic approach is required. First, clearly define your variables: the independent variable would be the potential interacting partner proteins, while the dependent variable would be the measured interaction strength or functional outcome . Based on evidence from related proteins, CCMFN2 likely functions in a complex similar to the 500-kDa complex described for AtCCMH and AtCcmF in Arabidopsis mitochondria .

A comprehensive experimental design should include these key methodological approaches:

  • Co-immunoprecipitation (Co-IP): Use anti-CCMFN2 antibodies to pull down protein complexes from mitochondrial extracts, followed by mass spectrometry or western blotting to identify interacting partners. This approach has been successful in demonstrating interactions between related proteins such as AtCCMH and bacterial CcmF .

  • Blue-native PAGE analysis: This technique allows visualization of intact protein complexes and has successfully revealed the co-localization of AtCCMH and AtCcmF N2 in a 500-kDa complex . Apply this method to investigate whether CCMFN2 participates in similar high-molecular-weight complexes.

  • Yeast two-hybrid assays: This approach can detect direct protein-protein interactions and has been used successfully to demonstrate interactions between AtCCMH and Arabidopsis apocytochrome c . Design constructs with CCMFN2 as bait to screen for potential interacting partners.

  • In vitro reconstitution experiments: Using purified recombinant proteins, assess direct biochemical interactions and potential enzymatic activities in a controlled environment.

Control for extraneous variables by including appropriate negative controls (non-interacting proteins) and positive controls (known interacting partners from the same pathway) .

What experimental approaches can be used to characterize the enzymatic properties of CCMFN2?

Characterizing the enzymatic properties of CCMFN2 requires a multifaceted approach that accounts for its predicted function in cytochrome c biogenesis. Based on studies of related proteins in the same pathway, CCMFN2 likely participates in redox reactions involved in the maturation of c-type cytochromes .

The following methodological approaches are recommended:

  • Reduction assays: Evaluate whether CCMFN2 contains redox-active cysteine residues that can form disulfide bonds. This can be tested by treating the protein with reducing agents like DTT or enzymatic reductants and assessing the change in thiol status using specific chemical probes such as DTNB (Ellman's reagent) .

  • Reduction potential measurements: Determine the redox potential of any identified redox-active centers within CCMFN2 using electrochemical techniques or redox-sensitive fluorescent proteins.

  • Substrate reduction assays: Assess whether CCMFN2 can reduce disulfide bridges in model peptides that mimic the CXXCH motif of apocytochrome c. Similar approaches have shown that reduced AtCCMH can reduce intra-disulfide bridges in model peptides .

  • Heme binding assays: Investigate potential heme binding properties using UV-visible spectroscopy, which can detect characteristic spectral changes upon heme binding.

  • Activity reconstitution experiments: Attempt to reconstitute cytochrome c maturation activity in vitro using purified components including CCMFN2, heme, and apocytochrome c substrates.

When designing these experiments, include appropriate controls and standard curves to ensure quantitative results. Consider temperature, pH, and ionic strength as important variables that may affect enzymatic activity .

How does the structure-function relationship of CCMFN2 compare with other CcmF-like proteins in different species?

The structure-function relationship of CCMFN2 can be analyzed by comparing it with other CcmF-like proteins across different species. In Arabidopsis, there are three genes encoding proteins similar to different domains of bacterial CcmF, with CCMFN2 representing one of these specialized components . This division of function appears to be a unique adaptation in plant mitochondria.

Comparative analysis should consider:

This comparative approach provides insights into how structural features correlate with the specialized function of CCMFN2 in plant mitochondria.

What approaches should be used to study the impact of CCMFN2 mutations on plant development and stress responses?

Studying the impact of CCMFN2 mutations on plant development and stress responses requires careful experimental design due to the essential nature of cytochrome c biogenesis. Complete knockout of related proteins like AtCCMH results in lethality at the torpedo stage of embryogenesis, suggesting that CCMFN2 may also be essential .

The following methodological approaches are recommended:

  • Conditional knockout systems: Use inducible promoters to control CCMFN2 expression, allowing for temporal regulation of gene silencing to bypass early developmental lethality.

  • CRISPR/Cas9 gene editing: Generate a range of mutations from complete knockouts to specific point mutations affecting predicted functional domains. Focus on mutations in conserved residues identified through sequence analysis.

  • RNAi or antisense approaches: Create plants with reduced but not eliminated CCMFN2 expression to study dosage effects on development and stress responses.

  • Complementation studies: For lethal mutations, perform complementation tests with wild-type or mutant versions of CCMFN2 to identify essential functional domains.

  • Phenotypic characterization: Analyze multiple parameters including:

    • Growth rates under normal and stress conditions

    • Photosynthetic efficiency

    • Mitochondrial respiration rates

    • Reactive oxygen species (ROS) production

    • Cytochrome c content and activity

  • Transcriptomic and proteomic analysis: Examine global changes in gene expression and protein abundance in response to altered CCMFN2 function, with particular attention to mitochondrial and stress-responsive pathways.

When designing these experiments, include appropriate controls such as wild-type plants and mutants of other components in the cytochrome c biogenesis pathway for comparison . Carefully document all experimental conditions to ensure reproducibility.

How can I optimize immunodetection methods for studying CCMFN2 localization and expression patterns in different plant tissues?

Optimizing immunodetection methods for CCMFN2 requires careful consideration of sample preparation, antibody specificity, and detection techniques. Based on previous studies with related proteins, CCMFN2 is expected to be localized in mitochondria, specifically in the inner membrane .

The following methodological approach is recommended:

  • Sample preparation optimization:

    • For western blotting: Establish efficient protocols for mitochondrial isolation from different plant tissues. Use differential centrifugation followed by Percoll gradient purification to obtain highly pure mitochondrial fractions .

    • For immunohistochemistry: Test different fixatives (paraformaldehyde, glutaraldehyde) and embedding methods to preserve antigenicity while maintaining cellular architecture.

  • Antibody validation and optimization:

    • Verify antibody specificity using recombinant CCMFN2 protein as a positive control .

    • Determine optimal antibody dilutions through titration experiments.

    • Consider using multiple antibodies targeting different epitopes if available.

    • Include appropriate controls: positive control (recombinant protein), negative control (pre-immune serum), and tissue from knockout plants if available.

  • Subcellular fractionation approach:

    • Separate outer membrane, inner membrane, and matrix fractions of mitochondria to precisely localize CCMFN2 within the organelle .

    • Use established marker proteins for different mitochondrial compartments as controls.

  • Detection methods:

    • For low abundance proteins like CCMFN2, enhance sensitivity using signal amplification systems such as biotin-streptavidin or tyramide signal amplification.

    • Consider fluorescence-based detection methods for co-localization studies with other mitochondrial proteins.

  • Expression pattern analysis:

    • Compare CCMFN2 expression across different tissues and developmental stages.

    • Examine expression under various stress conditions to identify potential regulatory mechanisms.

A systematic approach to optimization, with careful documentation of all parameters, will ensure reliable and reproducible results for CCMFN2 localization and expression studies.

What are the key considerations for maintaining protein integrity during recombinant CCMFN2 purification?

Maintaining protein integrity during recombinant CCMFN2 purification requires careful attention to multiple factors that can affect protein stability and activity. Based on the properties of related mitochondrial proteins, CCMFN2 likely contains redox-sensitive cysteine residues and may have hydrophobic domains associated with membrane interaction .

The following methodological considerations are critical:

  • Expression system selection: Choose an expression system that balances yield with proper folding. While E. coli systems provide high yield, eukaryotic systems may provide better folding for this mitochondrial protein . Cell-free expression systems can be advantageous for potentially toxic membrane proteins .

  • Buffer optimization:

    • pH: Maintain pH in the physiological range (7.0-8.0) to prevent denaturation.

    • Ionic strength: Include sufficient salt (typically 100-300 mM NaCl) to prevent non-specific interactions.

    • Reducing agents: If CCMFN2 contains redox-active cysteines, include mild reducing agents like 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation and disulfide bond formation.

    • Protease inhibitors: Add a complete protease inhibitor cocktail to prevent degradation.

  • Temperature control: Perform all purification steps at 4°C to minimize proteolytic degradation and protein denaturation.

  • Detergent selection: If CCMFN2 has membrane-associated domains, carefully select detergents for solubilization. Mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (CHAPS) are often suitable for maintaining native structure of membrane proteins.

  • Purification strategy:

    • Consider a multi-step purification approach utilizing affinity tags (His, GST) followed by size exclusion chromatography.

    • Aim for ≥85% purity as determined by SDS-PAGE for most research applications .

    • Validate protein identity using mass spectrometry and western blotting with specific antibodies .

  • Storage conditions:

    • Determine optimal protein concentration (typically 1-5 mg/ml).

    • Add stabilizing agents such as glycerol (10-20%) or specific ligands if known.

    • Flash-freeze in liquid nitrogen and store at -80°C in small aliquots to avoid freeze-thaw cycles.

Careful optimization of these parameters will help maintain CCMFN2 integrity throughout the purification process, ensuring that the final product retains its native structural and functional properties.

What controls should be included when studying CCMFN2 interactions with other components of the cytochrome c maturation pathway?

When investigating CCMFN2 interactions with other components of the cytochrome c maturation pathway, rigorous controls are essential to ensure valid and interpretable results. Based on studies of related proteins in this pathway, the following controls should be included :

  • Negative controls for protein-protein interaction studies:

    • Unrelated proteins of similar size and charge to rule out non-specific interactions.

    • Empty vectors in yeast two-hybrid or similar systems to identify false positives.

    • Mutated versions of CCMFN2 with disrupted interaction domains to confirm specificity.

    • Proteins known not to interact with the cytochrome c maturation system.

  • Positive controls for protein-protein interaction studies:

    • Known interacting partners within the cytochrome c maturation pathway.

    • Based on evidence from related proteins, AtCcmF N2 would be a logical positive control, as it has been shown to interact with AtCCMH in a 500-kDa complex .

    • The interaction between AtCCMH and apocytochrome c provides another model for expected interactions .

  • Controls for subcellular localization studies:

    • Established mitochondrial marker proteins for different subcompartments (outer membrane, inner membrane, matrix).

    • Markers for other cellular compartments to confirm specificity of mitochondrial localization.

  • Enzymatic activity controls:

    • Heat-inactivated CCMFN2 to demonstrate that observed activities require native protein.

    • Related proteins with known function to benchmark activity levels.

    • If testing redox activity, include controls with and without reducing agents.

  • Expression and knockdown controls:

    • Wild-type plants or cells as baseline controls.

    • Plants with altered expression of other components in the cytochrome c maturation pathway to assess pathway-specific effects.

    • Rescue experiments with wild-type CCMFN2 to confirm phenotype specificity.

The experimental design should include a between-subjects approach when comparing different genetic backgrounds, and a within-subjects approach when examining the same plants under different conditions to minimize variability . Careful documentation of all experimental parameters will ensure reproducibility and validity of the results.

What emerging technologies could advance our understanding of CCMFN2 function in cytochrome c biogenesis?

Several emerging technologies hold promise for advancing our understanding of CCMFN2 function in the cytochrome c biogenesis pathway. Based on current knowledge gaps and technological developments, these approaches could yield significant insights:

  • Cryo-electron microscopy (cryo-EM): This technique could reveal the structure of CCMFN2 alone or in complex with other components of the cytochrome c maturation machinery. Cryo-EM has revolutionized structural biology of membrane protein complexes and could provide unprecedented insights into how the 500-kDa complex containing CCMFN2 and related proteins is organized .

  • AlphaFold2 and other AI-based structural prediction tools: These computational approaches could predict CCMFN2 structure and interaction interfaces, guiding experimental design. Combining these predictions with experimental validation could accelerate understanding of structure-function relationships.

  • Single-molecule techniques: Methods such as single-molecule FRET could track conformational changes in CCMFN2 during the cytochrome c maturation process, revealing dynamic aspects of its function that are difficult to capture with ensemble measurements.

  • In-cell NMR spectroscopy: This emerging approach could provide structural information about CCMFN2 in its native cellular environment, bypassing potential artifacts from protein purification.

  • Proximity labeling approaches: Techniques like BioID or APEX2 could identify transient or weak interactions in the native cellular context by covalently tagging proteins that come into proximity with CCMFN2.

  • Optogenetic tools: Light-controlled systems could enable temporal regulation of CCMFN2 activity in vivo, allowing precise dissection of its function in different developmental stages and cellular conditions.

  • Microfluidic devices coupled with real-time imaging: These systems could allow high-throughput analysis of mitochondrial function in response to CCMFN2 perturbations under controlled conditions.

  • CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa): These techniques could enable fine-tuned modulation of CCMFN2 expression without completely eliminating the protein, which may be essential for plant survival based on the lethality observed with related proteins .

Integrating these emerging technologies with established biochemical and genetic approaches will provide a more comprehensive understanding of CCMFN2's role in cytochrome c biogenesis and plant mitochondrial function.

How might comparative studies across different plant species enhance our understanding of CCMFN2 evolution and function?

Comparative studies across different plant species can provide valuable insights into the evolution and function of CCMFN2. The high conservation of CCMH proteins among plant species (60-90% identity) suggests strong evolutionary pressure to maintain this function . A comprehensive comparative approach should include:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of CCMFN2 orthologs across plant lineages, from algae to angiosperms.

    • Compare with bacterial CcmF proteins to understand the evolutionary trajectory from prokaryotes to plant mitochondria.

    • Identify lineage-specific adaptations and conserved regions that may indicate functional importance.

  • Structural conservation analysis:

    • Map sequence conservation onto predicted structural models to identify functionally critical domains.

    • Compare the domain architecture of CCMFN2 across species to understand how the protein has evolved from the bacterial CcmF.

    • The three-domain structure seen in Arabidopsis (CCMFC, CCMFN1, CCMFN2) compared to the single CcmF protein in bacteria represents an interesting evolutionary divergence .

  • Functional complementation studies:

    • Test whether CCMFN2 from different plant species can complement Arabidopsis ccmfn2 mutants.

    • Investigate bacterial CcmF complementation in plant systems to understand functional conservation and divergence.

    • These studies could reveal lineage-specific adaptations in cytochrome c maturation.

  • Comparative expression and localization studies:

    • Analyze expression patterns of CCMFN2 orthologs across different plant lineages.

    • Determine whether subcellular localization is conserved across species.

    • Identify regulatory elements that control expression in different plant lineages.

  • Comparative interaction network analysis:

    • Map protein-protein interactions of CCMFN2 orthologs in different species.

    • Identify conserved and divergent interaction partners that may reveal functional adaptations.

    • The 500-kDa complex identified in Arabidopsis may serve as a reference point for comparison .

These comparative approaches would not only enhance our understanding of CCMFN2 evolution and function but also provide insights into the broader evolution of mitochondrial biogenesis pathways in plants. The unique system I cytochrome c maturation pathway in plant mitochondria, distinct from other eukaryotes, represents a fascinating example of evolutionary adaptation that merits detailed comparative investigation .

What are the most critical unresolved questions about CCMFN2 function that require further investigation?

Despite the progress in understanding components of the cytochrome c biogenesis pathway in plant mitochondria, several critical questions about CCMFN2 remain unresolved and warrant further investigation:

  • Precise biochemical function: While CCMFN2 is predicted to function in cytochrome c biogenesis based on homology to bacterial CcmF proteins, its exact biochemical role—whether in heme handling, apocytochrome recognition, or the actual ligation reaction—remains to be definitively established .

  • Structure-function relationships: The three-dimensional structure of CCMFN2 has not been determined, leaving critical questions about how its structure facilitates its function in the cytochrome c maturation process .

  • Composition and dynamics of the heme lyase complex: While related proteins like AtCCMH and AtCcmF N2 have been shown to co-localize in a 500-kDa complex, the complete composition of this complex, including whether CCMFN2 is a stable or transient component, remains to be fully characterized .

  • Physiological impact of CCMFN2 deficiency: The consequences of CCMFN2 dysfunction on plant development, stress responses, and mitochondrial function need further investigation. Based on the lethality of AtCCMH knockouts at the torpedo stage of embryogenesis, CCMFN2 may also be essential for plant survival .

  • Regulatory mechanisms: How CCMFN2 expression and activity are regulated in response to developmental cues, environmental stresses, and changes in cellular energy demands remains largely unknown.

  • Interaction with nuclear-encoded cytochrome c: The mechanism by which CCMFN2 and other components of the maturation machinery recognize and process nuclear-encoded apocytochrome c proteins requires further elucidation .

  • Role in different plant tissues and developmental stages: The tissue-specific and developmental roles of CCMFN2 in plants have not been comprehensively characterized.

  • Coordination with other mitochondrial biogenesis pathways: How cytochrome c maturation coordinates with other aspects of mitochondrial biogenesis and respiratory complex assembly remains an important area for investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.