Recombinant Arabidopsis thaliana Putative cytochrome c biogenesis ccmF N-terminal-like mitochondrial protein (CCMFN1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana Putative Cytochrome c Biogenesis ccmF N-Terminal-Like Mitochondrial Protein (CCMFN1) is a nuclear-encoded mitochondrial protein critical for the maturation of c-type cytochromes, which are essential for electron transport in respiration. CCMFN1 is part of the cytochrome c maturation (CCM) system, a conserved pathway in bacteria and plant mitochondria that ensures the covalent attachment of heme to apocytochromes. In Arabidopsis, CCMFN1 functions within a multi-protein complex alongside other Ccm components to facilitate heme ligation and redox regulation .

Gene Structure and Nomenclature

  • Gene Name: CCMFN1 (synonyms: ccb382, CC6BN1) .

  • Other Names: Cytochrome c biogenesis orf382 (mitochondrion) .

  • Protein Length: Partial or full-length recombinant forms are produced, depending on experimental requirements .

Protein Features

  • Function: Part of the CcmF complex, involved in heme delivery and apocytochrome c reduction .

  • Domains: Contains conserved motifs for interaction with heme and redox-active cysteines .

  • Localization: Inner mitochondrial membrane, facing the intermembrane space .

Table 2: Functional Interactions of CCMFN1

Interaction PartnerRole in CCM SystemReference
CcmCHeme chaperone
CcmH (AtCCMH)Thiol-reductase for apocytochrome c
Apocytochrome cSubstrate for heme ligation

Essentiality in Development

Knockout mutants of CCMFN1 or its interactors (e.g., AtCCMH) result in embryonic lethality at the torpedo stage due to disrupted respiration . Mutant embryos exhibit:

  • Cellular disorganization.

  • Absence of functional mitochondria and chloroplasts .

Regulatory Mechanisms

  • RNA Editing: CCMFN1 transcript editing is responsive to cellular energy status, modulated by AtPAP2 phosphatase interacting with MORF proteins .

  • Post-Translational Modifications: Variant isoforms detected via 2D BN-PAGE suggest phosphorylation or alternative splicing .

Comparative Analysis with Bacterial Systems

While bacterial CcmF is a single protein, Arabidopsis CcmF is split into three subunits (CCMFN1, CCMFN2, CCMFC). This divergence reflects adaptations for mitochondrial-specific heme handling and redox regulation .

Future Directions

  • Structural Studies: Cryo-EM analysis of the CCMFN1-containing complex.

  • Stress Responses: Investigating CCMFN1’s role under abiotic stress (e.g., iron or phosphorus deficiency) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery time estimates, please consult your local distributors.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for a maximum of one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CCMFN1; CC6BN1; CCB382; AtMg00830; At2g07783; Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 1; Cytochrome c biogenesis orf382
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CCMFN1
Target Protein Sequence
MSISIYEFFHYSLFLGLFVAFTYNKKQPPAFGAALAFWCILLSFLGLLFCHISNNLSNYN VLTANALFFYQISGTWSNHEGSILLWCWILNFYGFFFCYRGRPQSHNVLKQGGYRESLFF FFVLNFVKNSILSLLRYEQESGLKNQLYTPFVLRTLVDSELCSRRNRTFDGPALFYAPLY PERKIKNPLDAWRFRGSREGKRTHPLLHLARDDKERASSIDEQRIDGALGIALFFSFFLL ASSDPFVRNFFVCTEPLAELNPVLQDPILAIHPPCIYAGDVASAEGFGLCRSKMMNGIVA LHSPPMRKDAAEKNGTLLCSAGCVGSRITSELFTLKFKHVGAKCYPALLLRSNRSPLMLL RRRFFAFSSFWAGARSHSTKRY
Uniprot No.

Target Background

Function
This protein forms a complex with CCMFC, CCMFN2, and CCMH, facilitating the assembly of heme with c-type apocytochromes within mitochondria.
Database Links
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is CCMFN1 and what role does it play in cytochrome c biogenesis?

CCMFN1 (Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 1) is a crucial component of the cytochrome c maturation (CCM) system in Arabidopsis thaliana. It forms a complex with CCMFC, CCMFN2, and CCMH that performs the assembly of heme with c-type apocytochromes in mitochondria . This protein belongs to the CcmF/CycK/Ccl1/NrfE/CcsA family and functions specifically in System I of cytochrome c maturation, which is found in plant mitochondria, Gram-negative bacteria, and some archaea .

In Arabidopsis, the CCM system involves multiple proteins working together to achieve heme ligation and complete cytochrome c biogenesis. Unlike bacterial systems which utilize a single CcmF protein, plant mitochondria have split this function across multiple genes, including AtCcmFN1, AtCcmFN2, and AtCcmFC . These proteins, along with AtCCMH, integrate to form a high molecular weight heme lyase activity complex involved in the last critical step of cytochrome c maturation .

How does CCMFN1 interact with other proteins in the cytochrome c maturation pathway?

CCMFN1 participates in a complex network of protein interactions essential for cytochrome c maturation. The key interactions include:

Interacting PartnerInteraction TypeFunction
CCMFN2Direct complex formationForms part of the heme lyase complex
CCMFCDirect complex formationForms part of the heme lyase complex
CCMHDirect complex formationMaintains apocytochrome cysteines in a reduced state
Apocytochrome cIndirect (via complex)Target substrate for heme attachment

The CCMFN1-containing complex of approximately 500 kDa coordinates the critical final step of attaching heme to the CXXCH motif of apocytochrome c . This complex ensures the proper positioning of both the heme molecule and the apocytochrome to facilitate the formation of thioether bonds between the heme vinyl groups and the cysteine residues of the apocytochrome .

What are the molecular mechanisms of heme attachment facilitated by the CCMFN1-containing complex?

The attachment of heme to apocytochrome c involves a sophisticated molecular process in which CCMFN1 plays a crucial role. The process requires:

  • Heme delivery: The CcmABCE complex delivers heme to the IMS (intermembrane space) .

  • Redox control: AtCCMH interacts with apocytochrome c to maintain its cysteines in a reduced state, which is essential for thioether bond formation .

  • Heme positioning: The CCMFN1-containing complex positions the heme molecule correctly relative to the CXXCH motif of apocytochrome c .

  • Thioether bond formation: The complex catalyzes the formation of thioether bonds between the vinyl groups of heme b and the cysteine residues within the C₁XXC₂H motif of the apocytochrome .

Research has shown that the vinyl-2 group of heme forms a bond with the first cysteine (C₁) of the motif, while the vinyl-4 group bonds with the second cysteine (C₂) . This precise orientation is critical for proper cytochrome c function.

Importantly, experiments have demonstrated that heme transfer occurs effectively only when heme is in a reduced state, suggesting that the CCMFN1-containing complex may also participate in heme reduction or maintenance of the reduced state during transfer .

What is the evolutionary conservation of the Ccm system across different organisms?

The cytochrome c maturation (Ccm) system displays interesting evolutionary patterns across different domains of life:

System TypeOrganismsKey ComponentsCharacteristics
System I (Ccm)Gram-negative bacteria, archaea, plant mitochondriaCcmABCDEFGHMost complex system
System II (Ccs)β-, δ-, ε-proteobacteria, Gram-positive bacteria, chloroplastsCcsABIntermediate complexity
System IIIYeast and mammalian mitochondriaHCCS/CCHLSimplest system

Plant mitochondria have retained System I from their prokaryotic ancestors but with notable modifications:

  • Bacterial homologs to CcmD, CcmI, DsbD/CcdA, and CcmG proteins are absent in plant mitochondria .

  • The CcmF component is split into multiple genes (AtCcmFN1, AtCcmFN2, and AtCcmFC in Arabidopsis) .

  • The organization and regulation of the system have been adapted to the eukaryotic cellular context.

This evolutionary divergence suggests that the unique features of plant mitochondrial Ccm systems, including the specific role of CCMFN1, may be crucial adaptations to the plants' specific energetic and metabolic requirements.

What expression systems are optimal for producing recombinant CCMFN1 for functional studies?

The selection of an appropriate expression system is critical for obtaining functional recombinant CCMFN1. Based on available commercial preparations and research practices, several expression systems have been utilized:

Expression SystemAdvantagesChallengesApplications
E. coliCost-effective, high yield, rapid productionMay lack proper post-translational modifications, potential inclusion body formationBasic structural studies, antibody production
YeastEukaryotic processing, moderate yield, scalableLonger production time than E. coli, potential hyperglycosylationFunctional studies requiring some post-translational modifications
BaculovirusNear-native eukaryotic processing, high yieldTechnical complexity, higher cost, longer production timeComplex functional assays, structural studies
Mammalian cellMost authentic post-translational modificationsHighest cost, lowest yield, most complex protocolsStudies requiring fully authentic protein

The choice of affinity tags (e.g., His-tag, GST, Avi-tag biotinylation) should be considered based on the intended purification strategy and downstream applications . For instance, Avi-tag biotinylated CCMFN1 has been produced for applications requiring immobilization on streptavidin surfaces, such as protein interaction studies.

How can researchers assess the functional activity of recombinant CCMFN1 in vitro?

Assessing the functional activity of recombinant CCMFN1 requires specialized biochemical assays that evaluate its role in the cytochrome c maturation process:

  • Heme binding assays: UV-visible spectroscopy can be used to monitor the characteristic spectral changes that occur upon heme binding to components of the maturation complex . The ferric heme-CcmE complex, for example, has spectral properties similar to b-type cytochromes.

  • Complex formation analysis: Blue-native PAGE can detect the formation of the approximately 500 kDa complex containing CCMFN1, CCMFN2, CCMFC, and CCMH . This technique preserves native protein interactions and can verify proper assembly of the complex.

  • In vitro heme transfer assays: Researchers have developed systems to monitor the transfer of heme from holo-CcmE to apocytochrome c in vitro . Similar approaches could be adapted to study CCMFN1's role in this process, particularly by measuring the formation of covalently attached heme using spectroscopic methods or gel-based assays.

  • Thiol reduction assays: Since the cysteines in apocytochrome c must be maintained in a reduced state, the ability of components of the Ccm complex to participate in thiol-disulfide exchange reactions can be assessed using redox-sensitive dyes or thiol-reactive reagents .

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid assays, or surface plasmon resonance can verify interactions between CCMFN1 and other components of the Ccm system .

When designing these assays, it's essential to consider the membrane-associated nature of CCMFN1 and the need for appropriate detergents or membrane mimetics to maintain its native conformation and activity.

What genetic approaches can be used to study CCMFN1 function in planta?

Several genetic approaches can be employed to study CCMFN1 function in Arabidopsis thaliana:

When phenotyping plants with altered CCMFN1 expression, researchers should assess mitochondrial function (respiratory capacity, ATP production), cytochrome c content, and physiological parameters such as growth rate, developmental timing, and stress responses .

What are the major barriers to structural characterization of CCMFN1 and the Ccm complex?

Structural studies of CCMFN1 and the complete Ccm complex face several significant challenges:

  • Membrane protein crystallization: As an integral membrane protein, CCMFN1 presents the typical challenges associated with membrane protein crystallization, including maintaining stability during purification and finding appropriate detergents or lipidic environments.

  • Complex size and dynamics: The complete Ccm complex (~500 kDa) involves multiple components with dynamic interactions, making it difficult to capture a stable conformation suitable for structural determination.

  • Low natural abundance: The native levels of CCMFN1 in mitochondria are typically low, necessitating recombinant expression strategies that may not fully recapitulate the native protein.

  • Functional reconstitution: Ensuring that purified CCMFN1 retains its native conformation and functionality is essential for meaningful structural studies but can be technically challenging.

Recent advances in cryo-electron microscopy (cryo-EM) offer promising approaches for overcoming some of these barriers, as this technique can handle larger complexes and requires less protein than crystallography. Additionally, integrative structural biology approaches that combine multiple techniques (X-ray crystallography, NMR, SAXS, cross-linking mass spectrometry) may be necessary to fully elucidate the structure and dynamics of the Ccm complex.

How might a better understanding of CCMFN1 contribute to agricultural applications?

Insights into CCMFN1 function and the broader cytochrome c maturation system have several potential agricultural applications:

  • Improving energy metabolism: Optimizing mitochondrial respiration through enhanced cytochrome c biogenesis could potentially improve plant growth, yield, and stress tolerance.

  • Stress adaptation: Given the links between cytochrome c and stress responses, including programmed cell death , modulating CCMFN1 function might enhance plant resilience to environmental stresses.

  • Seed germination and vigor: Research has established that cytochrome c is crucial for proper seed germination through its role in respiratory metabolism and energy production . Enhancing CCMFN1 function might improve germination rates and seedling establishment, particularly under suboptimal conditions.

  • Developmental regulation: The cytochrome c maturation system influences embryo development , suggesting that fine-tuning CCMFN1 expression could potentially optimize developmental timing or plant architecture.

What epigenetic factors might influence CCMFN1 expression in Arabidopsis?

The regulation of mitochondrial biogenesis genes, including those involved in cytochrome c maturation, likely involves complex epigenetic mechanisms. Recent research on DNA methylation in Arabidopsis provides some insights:

  • Gene body methylation (gbM): Many constitutively expressed genes in Arabidopsis, particularly those encoding essential cellular functions, display gene body methylation . As a housekeeping gene involved in the fundamental process of respiration, CCMFN1 might be subject to this type of regulation.

  • DNA methylation readers: Recent research has identified proteins such as MBD2 that preferentially bind to gene body methylation in Arabidopsis . These readers might influence the expression of genes like CCMFN1 through recruitment of chromatin remodeling factors.

  • Chromatin state influence: The genomic region containing CCMFN1 would likely be characterized by specific chromatin states associated with constitutive expression. Research has identified nine distinct chromatin states in Arabidopsis, with genes showing different patterns of expression depending on their associated chromatin state .

  • Recombination landscape effects: Interestingly, the pattern of recombination in Arabidopsis is influenced by chromatin state , which might affect the evolution of CCMFN1 and related genes. Regions with active chromatin typically show higher recombination rates, potentially allowing for greater genetic diversity.

Future studies combining epigenome profiling with expression analysis under various developmental stages and stress conditions would help elucidate the specific epigenetic mechanisms regulating CCMFN1 expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.