Recombinant Arabidopsis thaliana Putative Delta (7)-sterol-C5 (6)-desaturase 2 (HDF7)

Shipped with Ice Packs
In Stock

Description

Biochemical Role in Sterol Biosynthesis

HDF7 catalyzes the C5(6)-desaturation of Δ7-sterols, a critical step in converting sitosterol precursors (e.g., Δ7-campesterol) to brassinosteroid (BR) precursors (e.g., Δ5,7-sitosterol) . This reaction is essential for maintaining sterol homeostasis and BR biosynthesis, which regulates plant growth and development.

Key Findings:

  • Mutation Impact: The ste1-1 mutant (Thr-114 → Ile) shows a 6-fold reduction in enzyme efficiency, confirming Thr-114’s role in catalysis .

  • Conserved Residues: Eight histidine residues in three motifs and Thr-114 are critical for enzyme activity, likely coordinating a non-haem iron center .

  • Enzyme Requirements: Activity depends on exogenous reductants (e.g., NADH) and oxygen, with sensitivity to cyanide and hydrophobic chelators .

Sterol Profiling in Mutants

GC-FID chromatograms reveal sterol accumulation patterns in ste1-1 and dwf7 mutants:

MutantAccumulated Sterols (Key Peaks)Complementation Result
ste1-1Δ5,7-sitosterol, isofucosterol, Δ7-sitosterol Full complementation with STE1-YFP
dwf7-17-dehydrocampestanol, 24-methylene cholesterol BR deficiency (e.g., reduced CR)

Note: Full complementation restores sitosterol (Δ5-sitosterol) levels, critical for BR biosynthesis .

Site-Directed Mutagenesis Insights

ResidueMutationEffect on ActivityFunctional Role
Thr-114Thr → Ile6-fold reductionCatalytic site coordination
His-313His → AlaLoss of activityNon-haem iron center ligation
His-rich motifsMutationsEnzyme inactivationStructural/functional stabilization

Applications in Plant Research

HDF7 is pivotal for studying:

  1. Sterol-Brassinosteroid Pathways: Linking sterol metabolism to BR-regulated growth.

  2. Mutant Phenotypes: dwf7 mutants exhibit dwarfism due to BR deficiency, highlighting HDF7’s role in sterol-to-BR conversion .

  3. Enzyme Engineering: Thr-114 and His motifs are targets for improving desaturation efficiency in biotechnological applications .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for prioritized development and implementation.
Synonyms
HDF7; At3g02590; F16B3.22; Putative Delta(7-sterol-C5(6-desaturase 2; Delta(7-sterol-C5-desaturase 2; Delta-7-C-5 sterol desaturase 2; Homolog of DWF7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HDF7
Target Protein Sequence
MAATMADYNDQIVNETSFYNRMVLSHLLPVNLWEPLPHFLQTWLRNYLAGNILYFISGFL WCFYIYYLKLNVYVPKESIPTRKAMLLQIYVAMKAMPWYTLLPAVSEYMIEHGWTKCYST LDHFNWFLCFLYIALYLVLVEFMIYWVHKELHDIKFLYKHLHATHHMYNKQNTLSPFAGL AFHPLDGILQAIPHVIALFIVPIHLITHLSLLFLEGIWTASIHDCIHGNIWPIMGAGYHT IHHTTYKHNYGHYTIWMDWMFGSLMVPLAEKDSFKEKEK
Uniprot No.

Target Background

Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana HDF7 and what is its function in sterol biosynthesis?

HDF7 (Putative Delta(7)-sterol-C5(6)-desaturase 2) is an enzyme belonging to the sterol desaturase family in Arabidopsis thaliana. It is involved in sterol biosynthesis, specifically in the desaturation process that introduces double bonds into sterol molecules . Based on its classification and functional similarities to STE1 (Delta(7)-sterol-C5(6)-desaturase 1), HDF7 likely catalyzes the introduction of a delta-5 bond into delta-7-sterols to yield delta-5,7-sterols. This enzymatic step is crucial for synthesizing important plant sterols such as sitosterol and campesterol, which serve as precursors for growth-promoting brassinosteroids .

The sterol desaturation pathway in plants follows the sequence delta-7-sterol → delta-5,7-sterol → delta-5-sterol, as demonstrated in studies of similar desaturases . This process is essential for proper membrane structure and function, as well as for the biosynthesis of plant steroid hormones that regulate development.

How is HDF7 related to STE1 (Delta(7)-sterol-C5(6)-desaturase 1)?

HDF7 and STE1 are paralogous enzymes in Arabidopsis thaliana, both belonging to the sterol desaturase family . According to STRING interaction network data, these proteins show functional association, suggesting they work in the same pathway or have overlapping functions .

Key relationships include:

  • Functional similarity: Both enzymes likely catalyze the conversion of delta-7-sterols to delta-5,7-sterols.

  • Pathway integration: Both participate in the biosynthesis of plant sterols including sitosterol and campesterol, precursors for brassinosteroids .

  • Potential redundancy: The existence of multiple desaturases suggests either functional redundancy or specialization within the sterol biosynthesis pathway.

  • Sequence homology: As members of the same enzyme family, they share conserved domains critical for catalytic function.

The dwf7/ste1 mutant shows defects in the delta-7-sterol-C5(6)-desaturase step , indicating the importance of this enzymatic function. Understanding the specific roles of HDF7 versus STE1 requires comparative functional studies.

What are the optimal conditions for expressing and purifying recombinant HDF7?

Optimal conditions for expressing and purifying recombinant HDF7 depend on the chosen expression system and research objectives. Here are methodological recommendations based on similar recombinant proteins:

For E. coli Expression:

  • Vector selection: pET28a with His-tag has been successfully used .

  • Expression strain: BL21(DE3) or Rosetta for membrane proteins.

  • Induction conditions: Low temperature (16-20°C) with reduced IPTG (0.1-0.5 mM) to minimize inclusion bodies.

  • Membrane extraction: Use mild detergents (DDM, CHAPS) for solubilization.

For Arabidopsis Expression:

  • Use the rdr6-11 background to minimize gene silencing .

  • Strong promoters (35S) drive high expression levels.

  • Establish cell cultures for continuous production.

Purification Strategy:

  • For His-tagged HDF7: Immobilized metal affinity chromatography (IMAC) .

  • Include appropriate detergents in all buffers to maintain solubility.

  • Consider size exclusion chromatography as a second purification step.

  • Store at -20°C to -80°C with glycerol as a cryoprotectant .

  • Verify purity by SDS-PAGE (aim for >85%) and identity by western blotting or mass spectrometry .

These methodological recommendations provide a starting point, with optimization required based on experimental outcomes and specific research goals.

How can I verify the enzymatic activity of recombinant HDF7?

Verifying the enzymatic activity of recombinant HDF7 requires assays that measure its ability to catalyze the desaturation of sterols. Based on studies of similar desaturases, the following methodological approaches are recommended:

  • In Vitro Enzymatic Assays:

    • Prepare microsomes from cells expressing HDF7

    • Incubate with delta-7-sterol substrates

    • Include essential cofactors: molecular oxygen and NADH

    • Analyze formation of delta-5,7-sterol products by GC-MS or HPLC

  • Yeast Complementation Assays:

    • Express HDF7 in erg3 yeast mutants lacking endogenous delta-7-sterol-C5(6)-desaturase

    • Measure restoration of ergosterol synthesis

    • Compare with STE1 complementation as positive control

  • Cofactor and Inhibitor Studies:

    • Test NADH vs. NADPH efficiency (NADH is typically more efficient)

    • Evaluate NAD+ stimulation effects

    • Assess sensitivity to known inhibitors: cyanide, 1,10-phenanthroline, salicylhydroxamic acid

  • Substrate Specificity Analysis:

    • Test activity with different delta-7-sterols having various C24 substituents

    • Compare preference for 24-methylene/ethylidene vs. 24-ethyl-substituted delta-7-sterols

Critical controls include heat-inactivated enzyme, cofactor omission, anaerobic conditions, and comparison with STE1 activity. Results should be quantified as specific activity (nmol product/min/mg protein) and validated with authentic standards.

What are the known protein-protein interactions of HDF7 and how can they be studied?

According to STRING interaction network data , HDF7 has several predicted protein-protein interactions that can be investigated using various complementary approaches:

Key Interaction Partners:

  • STE1 (Delta(7)-sterol-C5(6)-desaturase 1) - Paralog with similar function

  • ERG28 (Ergosterol biosynthetic protein 28) - Involved in sterol biosynthesis

  • CYP51G1 and CYP51G2 (Sterol 14-demethylase enzymes) - Part of sterol pathway

  • Other sterol biosynthetic pathway proteins

Methodological Approaches:

TechniqueMethodologyAdvantagesLimitations
Co-ImmunoprecipitationExpress tagged HDF7, precipitate with tag antibodies, identify coprecipitating proteinsDetects direct physical interactions in physiological contextMay miss weak/transient interactions
Split-Ubiquitin Yeast Two-HybridCreate membrane-compatible Y2H constructs with HDF7 and potential partnersSpecialized for membrane proteinsCan generate false positives
Bimolecular Fluorescence ComplementationFuse HDF7 and partners to complementary fluorescent protein fragmentsProvides spatial informationIrreversible complex formation
Proximity-Dependent LabelingFuse HDF7 to BioID or APEX2 enzymesDetects transient interactions in native compartmentsNon-specific labeling possible
Genetic Interaction StudiesAnalyze phenotypes of single and double mutantsReveals functional relationshipsIndirect evidence of interaction

When studying HDF7 interactions, its membrane localization presents technical challenges for traditional assays. Complementary approaches and appropriate controls are essential for reliable results, particularly cross-validation between in vitro and in vivo methods.

How do mutations in HDF7 affect plant sterol biosynthesis and plant development?

Studying the effects of HDF7 mutations on sterol biosynthesis and plant development requires integrated genetic, biochemical, and phenotypic analyses. Based on studies of similar genes like STE1, the following methodological approach is recommended:

Generation and Characterization of HDF7 Mutants:

  • Creation strategies:

    • CRISPR/Cas9 gene editing for targeted mutations

    • Screening existing T-DNA insertion collections

    • EMS mutagenesis for point mutations (similar to ste1-1)

  • Sterol profile analysis:

    • Extract total sterols from wild-type and mutant plants

    • Analyze composition by GC-MS to identify specific changes

    • Compare with profiles from ste1 mutants

    • Based on the ste1-1 study, expect altered ratios of delta-5,7-sterols to delta-7-sterols

  • Developmental phenotyping:

    • Document growth parameters (height, leaf area, flowering time)

    • Analyze cell morphology and tissue organization

    • Test responses to hormones, particularly brassinosteroids

    • The dwf7/ste1 mutant shows distinct developmental abnormalities related to sterol deficiency

  • Genetic interaction studies:

    • Generate hdf7/ste1 double mutants to assess redundancy

    • Create combinations with other sterol biosynthesis mutants

    • Perform complementation tests with wild-type genes

For a comprehensive understanding, integrate sterol profile data with transcriptome analysis and developmental phenotyping, focusing particularly on pathways known to be affected by sterol composition alterations.

What are the differences between HDF7 and STE1 in terms of substrate specificity and regulation?

Understanding the differences between HDF7 and STE1 requires comparative analysis of their substrate specificities and regulatory mechanisms. The following methodological approach is recommended:

Substrate Specificity Analysis:

  • In vitro enzyme assays with purified recombinant proteins and various delta-7-sterol substrates

  • Measurement of reaction rates (Vmax) and substrate affinities (Km) for each substrate

  • Comparison of kinetic parameters in table format:

ParameterHDF7STE1Fold Difference
Km (Delta-7-sitosterol)x μMy μMx/y
Vmax (Delta-7-sitosterol)x μmol/min/mgy μmol/min/mgx/y
kcat/Km (Delta-7-sitosterol)x M⁻¹s⁻¹y M⁻¹s⁻¹x/y
NADH Kmx μMy μMx/y
Optimal pHxy-
IC50 (Cyanide)x μMy μMx/y

Regulatory Difference Analysis:

  • Promoter studies using reporter gene fusions

  • Expression profiling across tissues and conditions using RT-qPCR or RNA-seq

  • Protein stability and post-translational modification analysis

  • Cross-complementation tests expressing HDF7 in ste1 mutants and vice versa

Based on studies of maize desaturase , specific attention should be paid to differences in preference for sterols with varying C-24 substituents (methylene, ethylidene, or ethyl groups), as this represents a likely point of functional specialization between the two enzymes.

Can recombinant HDF7 be used for structural studies, and what approaches have been successful?

Structural studies of recombinant HDF7 would provide valuable insights into its catalytic mechanism and substrate specificity. The following methodological approaches are recommended:

X-ray Crystallography:

  • As a membrane protein, HDF7 presents crystallization challenges

  • Consider protein engineering to improve crystallization properties

  • Use the sitting drop vapor diffusion method, which was successful for Arabidopsis threonine synthase

  • Co-crystallization with substrate analogs or inhibitors may stabilize specific conformations

Cryo-Electron Microscopy:

  • Purify HDF7 in detergent micelles or reconstitute into nanodiscs

  • For small proteins like HDF7, consider multimerization strategies

  • This approach avoids the need for protein crystallization

Computational Structural Biology:

  • Generate homology models based on related proteins with known structures

  • Simulate protein behavior in membrane environments using molecular dynamics

  • Identify conserved structural features based on alignment with known delta-7-sterol-C5(6)-desaturases

Expression considerations for structural studies:

  • Optimize construct design (consider removing flexible regions)

  • Screen multiple detergents for extraction and stability

  • Use size-exclusion chromatography to ensure monodispersity

  • Implement thermal stability assays to identify optimal buffer conditions

These approaches can be integrated to develop a comprehensive structural understanding of HDF7, which would significantly advance our knowledge of plant sterol desaturases.

What assays can be used to measure HDF7 enzymatic activity?

Measuring HDF7 enzymatic activity requires specialized assays that detect the conversion of delta-7-sterols to delta-5,7-sterols. The following methodological approaches are recommended:

  • Microsomal Enzyme Assays:

    • Preparation: Isolate microsomes from expression systems through differential centrifugation

    • Reaction components:

      • Microsomal protein containing HDF7 (50-200 μg)

      • Delta-7-sterol substrate (10-50 μM)

      • NADH (1-2 mM) as preferred cofactor

      • Optional NAD+ (0.5-1 mM) for activity enhancement

      • Buffer (pH 7.2-7.5)

    • Incubation: 30-60 minutes at 30°C

    • Analysis: Extract sterols using organic solvents and analyze by GC-MS or HPLC

  • Spectrophotometric Assays:

    • Monitor NADH oxidation by measuring absorbance decrease at 340 nm

    • Calculate initial rates from the linear portion of absorption curve

    • Confirm correlation between NADH oxidation and product formation

  • Oxygen Consumption Assays:

    • Use oxygen electrodes to measure real-time oxygen consumption rates

    • Provides kinetic data suitable for initial rate determinations

    • Include controls without substrate to account for background consumption

  • Yeast Complementation Assays:

    • Express HDF7 in erg3 yeast mutants lacking endogenous desaturase activity

    • Extract and analyze sterol profiles to assess functional complementation

    • Compare with STE1 complementation as positive control

Essential controls include heat-inactivated enzyme, cofactor omission, oxygen dependency tests, and inclusion of known desaturase inhibitors like cyanide or 1,10-phenanthroline . For valid comparisons with published data, standardize activity as nmol product/min/mg protein.

How can I study the integration of HDF7 into membranes and its topology?

Studying membrane integration and topology of HDF7 requires specialized techniques that reveal how this desaturase is oriented and embedded in biological membranes. The following methodological approaches are recommended:

Membrane Localization Studies:

  • Differential centrifugation to separate cellular components

  • Immunoblotting with HDF7 antibodies or against tag

  • Include marker proteins for different cellular compartments as controls

Topology Determination:

  • Protease Protection Assays:

    • Treat isolated membranes with proteases with/without permeabilization

    • Analyze protected fragments by western blotting

    • Reveals domains exposed or protected by the membrane

  • Chemical Labeling Techniques:

    • Surface biotinylation using membrane-impermeable reagents

    • Introduce cysteine residues at specific positions and test accessibility

    • MTSEA-Biotin labeling for specific cysteine residues in predicted loops

  • Fluorescence-Based Approaches:

    • Create GFP fusions at different positions

    • Analyze localization by confocal microscopy

    • Use pH-sensitive GFP variants to determine lumenal vs. cytosolic orientation

  • Glycosylation Mapping:

    • Introduce glycosylation sites at different positions in predicted loops

    • Analyze glycosylation patterns (lumenal = glycosylated, cytosolic = unglycosylated)

Data Integration and Modeling:

  • Combine experimental data with transmembrane prediction algorithms

  • Develop a comprehensive topology model showing membrane orientation

  • Relate topology findings to enzymatic activity and substrate binding

Using multiple complementary approaches is essential for reliable topology determination, as each method has inherent limitations. Comparison with related proteins like STE1 can provide additional validation of the proposed topology model.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.