Recombinant Arabidopsis thaliana Putative DUF21 domain-containing protein At3g13070, chloroplastic (CBSDUFCH1)

Shipped with Ice Packs
In Stock

Description

Domain Architecture and Classification

CBSDUFCH1 belongs to the CBS domain-containing protein (CDCP) family, which is evolutionarily conserved across plants. Key features include:

  • CBS Domain: Implicated in stress response regulation, including salinity, drought, and temperature extremes .

  • DUF21 Domain: A functionally uncharacterized domain often co-occurring with CBS domains in plant proteins .

Phylogenetic analyses reveal orthologs of CBSDUFCH1 in Oryza species (e.g., O. sativa, O. meridionalis), suggesting conserved roles in plant physiology .

Stress Response Roles

  • CBSDUFCH1 promoters harbor stress-responsive cis-elements, including ARE (anaerobic response), ABRE (abscisic acid signaling), and LTR (low-temperature tolerance) .

  • Orthologs in Oryza exhibit differential expression under hypoxia and oxidative stress, implying roles in redox homeostasis .

Developmental Regulation

  • CBSDUFCH1 homologs in Oryza sativa show elevated expression in embryos and endosperm, suggesting involvement in seed development .

  • Interaction with E2Fb transcription factors hints at roles in cell division and DNA repair .

Research Applications

CBSDUFCH1 is utilized in:

  • Stress Physiology Studies: Investigating plant adaptation to abiotic stresses (e.g., salinity, UV exposure) .

  • Protein Interaction Networks: Identifying partners via yeast two-hybrid or co-IP assays .

  • Evolutionary Analyses: Comparing domain architectures across monocots and dicots .

Future Directions

Unresolved questions include:

  • Mechanistic roles of the DUF21 domain.

  • Specific interactors and downstream pathways.

  • Applications in crop engineering for stress resilience .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CBSDUFCH1; At3g13070; MJG19.2; Putative DUF21 domain-containing protein At3g13070, chloroplastic; CBS domain-containing protein CBSDUFCH1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
72-661
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CBSDUFCH1
Target Protein Sequence
FMLFSSSQCHEGSQRKSDSGEKELESIKVLLKRGIVIGALVCGVFLYGCQKVLASAGVVE AGYEVFGQSVVLFKNALPKIYQVLTVLREQGLILAALLSLSAFFSMAETSITTLWPWKVR ELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIFGEAGVSAATGL MTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYLSMGILKILGLK GRSEPYVTEDELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDVVAIDAS ASLVDFHSMWVTHQYSRVPVFEQRIDNIVGIAYAMDLLDYVQKGDLLESTSVGDMAHKPA YFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEEI QKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSGFVCEAFGYIPKTGES VKVVLEKESWEEDGEEEEGKQERQEPKEKNQIYRVEILAGNARKVSAVRFERVNDMDQVS EASDVKSMVPKFVRKWSSEEDDGNLSNEEDQSENAVLDEHVLADNSKKQQ
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G13070

STRING: 3702.AT3G13070.1

UniGene: At.39497

Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant CBSDUFCH1 protein?

Based on experimental recommendations, recombinant CBSDUFCH1 protein should be stored as follows:

  • Storage temperature: -20°C for regular storage; -80°C for extended storage

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Working conditions: Store working aliquots at 4°C for up to one week

  • Important note: Repeated freezing and thawing is not recommended as it may lead to protein degradation and loss of activity

For optimal experimental results, it's advisable to prepare small aliquots upon receipt of the protein to minimize freeze-thaw cycles.

What are the recommended methods for studying CBSDUFCH1 subcellular localization in Arabidopsis?

To study the subcellular localization of CBSDUFCH1, several complementary approaches can be employed:

  • GFP fusion protein expression:

    • Clone the CBSDUFCH1 coding sequence into a plant expression vector (such as pEarleyGate 103) to generate a CBSDUFCH1-GFP fusion protein driven by a strong promoter like CaMV35S

    • Transform the construct into Arabidopsis mesophyll protoplasts using PEG-mediated transfection

    • Visualize using confocal microscopy to determine localization patterns

  • Immunolocalization with specific antibodies:

    • Generate antibodies against purified recombinant CBSDUFCH1

    • Perform immunolabeling on fixed plant tissues

    • Use fluorescent secondary antibodies for visualization

  • Chloroplast isolation and western blotting:

    • Isolate intact chloroplasts from Arabidopsis leaves

    • Perform subfractionation to separate thylakoid membranes, stroma, and envelope membranes

    • Use western blotting with anti-CBSDUFCH1 antibodies to determine the specific chloroplastic compartment where the protein resides

The combined results from these approaches provide robust evidence for the protein's localization pattern within the chloroplast and potentially other cellular compartments.

How can researchers generate and validate CBSDUFCH1 knockout mutants in Arabidopsis?

Generating and validating CBSDUFCH1 knockout mutants involves several steps:

What is the potential role of CBSDUFCH1 in brassinosteroid signaling based on homology to other DUF21 proteins?

Recent research on DUF21 domain-containing proteins in other plant species provides valuable insights into potential functions of CBSDUFCH1:

  • Evidence from watermelon studies:

    • A DUF21 domain-containing protein (ClDUF21) in watermelon was identified as regulating plant dwarfing

    • ClDUF21 directly interacts with ClDWF1, a key enzyme in brassinosteroid biosynthesis

    • Knockout mutants of ClDUF21 display pronounced dwarfing phenotypes

  • Conservation of function:

    • Similar function was confirmed in cucumber, where CsDUF21 interacts with CsDWF1

    • This suggests evolutionary conservation of DUF21 protein function across different plant species

  • Experimental approach to test this in Arabidopsis:

    • Perform yeast two-hybrid or bimolecular fluorescence complementation assays to test potential interaction between CBSDUFCH1 and Arabidopsis DWF1

    • Compare brassinosteroid levels in wild-type and cbsdufch1 mutant plants using LC-MS/MS

    • Test whether exogenous brassinosteroid application can rescue potential growth defects in cbsdufch1 mutants

    • Examine expression of brassinosteroid-responsive genes in cbsdufch1 mutants

Given the evidence from cucurbits, it's reasonable to hypothesize that CBSDUFCH1 may play a role in brassinosteroid biosynthesis or signaling in Arabidopsis, potentially affecting plant growth and development.

How does CBSDUFCH1 respond to abiotic stress conditions in Arabidopsis?

To investigate CBSDUFCH1 response to abiotic stresses, researchers should consider:

  • Expression analysis:

    • Monitor CBSDUFCH1 transcript levels under various abiotic stresses (drought, salt, cold, heat) using qRT-PCR

    • Analyze publicly available transcriptome data to identify conditions that alter CBSDUFCH1 expression

    • Generate transgenic plants expressing CBSDUFCH1 promoter:GUS constructs to visualize tissue-specific expression changes under stress

  • Phenotypic assessment of knockout/overexpression lines:

    • Compare stress tolerance of wild-type, cbsdufch1 knockout, and CBSDUFCH1 overexpression lines

    • Measure physiological parameters such as:

      • Relative water content

      • Electrolyte leakage

      • Photosynthetic efficiency

      • Reactive oxygen species accumulation

      • Stress-responsive metabolite levels

  • Based on other DUF proteins' functions:

    • DUF569 has been identified as a positive regulator of drought stress response in Arabidopsis, suggesting potential roles for other DUF-domain proteins in stress adaptation

    • Some CBSDUF proteins in soybean show differential expression under abiotic stresses, indicating a potential role in stress responses

A comprehensive analysis would include a time-course study of both transcript and protein levels under different stress conditions, combined with physiological and biochemical measurements to understand the functional significance of any observed changes.

What are the predicted protein-protein interaction partners of CBSDUFCH1 and how can they be experimentally validated?

Potential protein interaction partners can be identified and validated through:

  • In silico prediction:

    • Use protein interaction databases like STRING (3702.AT3G13070.1) to identify potential interactors based on:

      • Co-expression data

      • Text mining evidence

      • Homology-based predictions from other species

  • Experimental validation methods:

    • Yeast two-hybrid (Y2H) screening:

      • Use CBSDUFCH1 as bait to screen Arabidopsis cDNA libraries

      • Validate positive interactions through directed Y2H assays

    • Co-immunoprecipitation (Co-IP):

      • Express tagged CBSDUFCH1 in Arabidopsis

      • Immunoprecipitate the protein complex and identify interactors using mass spectrometry

    • Bimolecular Fluorescence Complementation (BiFC):

      • Fuse CBSDUFCH1 and candidate interactors to complementary fragments of a fluorescent protein

      • Co-express in Arabidopsis protoplasts to visualize interactions in vivo

    • Pull-down assays:

      • Use purified recombinant CBSDUFCH1 to pull down interacting proteins from plant extracts

      • Identify bound proteins by mass spectrometry

  • Confirmation in planta:

    • Generate double mutants of CBSDUFCH1 and its interaction partners

    • Analyze phenotypes for genetic interactions (synergistic, epistatic, or additive effects)

    • Assess co-localization using fluorescently tagged proteins

Based on studies of related proteins, potential interactors might include components of brassinosteroid synthesis pathway (like DWF1) or proteins involved in transmembrane transport processes, given its predicted transmembrane domain structure.

How does the CBS domain in CBSDUFCH1 contribute to its function and regulation?

The CBS (Cystathionine-β-Synthase) domains found in CBSDUFCH1 likely play important regulatory roles:

  • Known functions of CBS domains:

    • CBS domains typically form dimeric structures that can bind adenosyl groups (ATP, AMP, SAM)

    • They often function as sensors of cellular energy status and regulate protein activity accordingly

    • In other proteins, CBS domains mediate protein-protein interactions

  • Experimental approaches to study CBS domain function:

    • Domain deletion/mutation analysis:

      • Generate constructs with deleted or mutated CBS domains

      • Express in cbsdufch1 knockout background and assess complementation

      • Compare phenotypes and protein activity with wild-type protein

    • Biochemical characterization:

      • Express and purify recombinant CBS domains

      • Perform ligand binding assays to identify potential metabolite regulators

      • Analyze structural changes upon ligand binding using circular dichroism or thermal shift assays

    • Interactome comparison:

      • Compare protein interaction profiles of full-length CBSDUFCH1 versus CBS domain deletion mutants

      • Identify interactions dependent on the CBS domains

  • Bioinformatic analysis:

    • Perform structural modeling of the CBS domains

    • Compare with characterized CBS domains in other proteins

    • Identify conserved residues that might be involved in ligand binding or protein interactions

Understanding the regulatory role of CBS domains could provide insights into how CBSDUFCH1 activity is modulated in response to changing cellular conditions.

How conserved is the DUF21 domain across plant species and what does this suggest about its evolutionary importance?

The conservation pattern of DUF21 domains provides insights into their functional significance:

  • Comparative genomic analysis:

    • DUF21 domain-containing proteins have been identified across diverse plant species including Arabidopsis, watermelon, cucumber, and soybean

    • A comprehensive analysis should include:

      • Sequence alignment of DUF21 domains from multiple species

      • Identification of conserved motifs and residues

      • Phylogenetic tree construction to understand evolutionary relationships

  • Functional conservation assessment:

    • Evidence suggests functional conservation between species:

      • ClDUF21 in watermelon and CsDUF21 in cucumber both interact with DWF1 homologs

      • Both affect plant height through similar mechanisms

    • Testing functional complementation:

      • Express CBSDUFCH1 in ClDUF21 knockout watermelon to test cross-species functional complementation

      • This approach would validate functional conservation across evolutionary distance

  • Domain architecture comparison:

    • Analyze co-occurrence patterns of DUF21 with other domains across species

    • Compare genomic context and synteny around DUF21-encoding genes

    • Assess selection pressure on different regions of the protein using dN/dS analysis

The significant conservation of DUF21 domain-containing proteins across different plant species suggests an important fundamental role in plant biology that has been maintained through evolutionary time.

How does CBSDUFCH1 relate to other DUF domain-containing proteins in Arabidopsis?

Arabidopsis contains numerous DUF domain-containing proteins with diverse functions:

  • Comparative analysis of DUF proteins in Arabidopsis:

    • Over 250 different DUF families exist in Arabidopsis

    • Several have been functionally characterized:

      • DUF247: Affects cell wall polysaccharides and plant growth

      • DUF506: Shows diverse subcellular localizations including chloroplast, cytoplasm, plasma membrane, and nucleus

      • DUF569: Functions as a positive regulator of drought stress response

      • DUF642: Involved in cell wall biogenesis

  • Functional grouping of DUF proteins:

    • Based on characterized DUF proteins, several functional themes emerge:

      • Cell wall modification and biogenesis

      • Stress responses

      • Hormone signaling

      • Development regulation

  • Research methodology:

    • Perform co-expression network analysis of all DUF genes in Arabidopsis

    • Identify clusters of functionally related genes

    • Conduct comparative phenomics of various DUF mutants

    • Analyze promoter elements to identify common regulatory mechanisms

A systematic comparative analysis of DUF proteins could reveal functional relationships and help place CBSDUFCH1 within the broader context of this diverse protein family in plant biology.

How might CBSDUFCH1 interact with other chloroplastic proteins to influence plant development?

CBSDUFCH1's chloroplastic localization suggests potential roles in chloroplast-related processes:

  • Chloroplast proteome interaction network:

    • Perform proximity labeling (BioID or TurboID fused to CBSDUFCH1) to identify neighboring proteins in the chloroplast

    • Analyze chloroplast proteome alterations in cbsdufch1 mutants using quantitative proteomics

    • Map CBSDUFCH1 into known chloroplast protein interaction networks

  • Analysis of chloroplast-dependent phenotypes:

    • Examine photosynthetic parameters in cbsdufch1 mutants:

      • Chlorophyll fluorescence measurements (Fv/Fm, ETR, NPQ)

      • Photosynthetic rate and efficiency

      • Chloroplast ultrastructure using transmission electron microscopy

    • Assess retrograde signaling from chloroplast to nucleus:

      • Analyze nuclear gene expression changes in response to chloroplast perturbation in wild-type vs. cbsdufch1 mutants

  • Potential signaling mechanisms:

    • Investigate whether CBSDUFCH1 plays a role in chloroplast-to-nucleus retrograde signaling

    • Examine metabolite profiles that might be affected by CBSDUFCH1 function

    • Study potential links between chloroplast function and brassinosteroid responses

Understanding the role of CBSDUFCH1 in chloroplast function could reveal novel connections between organelle biology and whole-plant development.

What experimental approaches could be used to understand the function of the DUF21 domain, which currently has no known function?

To characterize the enigmatic DUF21 domain:

  • Structure-function analysis:

    • Generate a series of deletion and point mutations within the DUF21 domain

    • Express mutant versions in cbsdufch1 knockout background

    • Assess complementation efficiency to identify critical residues

    • Solve the three-dimensional structure using X-ray crystallography or cryo-EM

  • Domain-specific protein interactions:

    • Use the isolated DUF21 domain as bait in Y2H or pull-down assays

    • Compare interactors with those of the full-length protein

    • Identify domain-specific binding partners

  • Chimeric protein analysis:

    • Create chimeric proteins by swapping the DUF21 domain between CBSDUFCH1 and other DUF21-containing proteins

    • Express in respective mutant backgrounds

    • Determine whether DUF21 domains are functionally interchangeable between different proteins

  • Comparative genomics approach:

    • Identify highly conserved residues across DUF21 domains from diverse species

    • Generate targeted mutations in these residues

    • Test functional consequences in vivo

  • Biochemical activity screening:

    • Test purified DUF21 domain for various enzymatic activities

    • Screen for potential ligand binding using thermal shift assays

    • Analyze post-translational modifications that might regulate the domain

A combination of these approaches could help decipher the molecular function of this domain and potentially lead to its redesignation with a function-based name.

How does CBSDUFCH1 contribute to plant adaptation in different environmental conditions?

To understand the adaptive significance of CBSDUFCH1:

  • Phenotypic characterization across environments:

    • Compare wild-type and cbsdufch1 mutant performance across:

      • Different light intensities and qualities

      • Temperature ranges

      • Drought and salt stress conditions

      • Nutrient availability gradients

    • Measure multiple fitness components:

      • Growth rate

      • Reproductive output

      • Resource allocation patterns

      • Survival under stress

  • Natural variation analysis:

    • Sequence CBSDUFCH1 across multiple Arabidopsis ecotypes

    • Associate sequence polymorphisms with environmental parameters of collection sites

    • Test for signals of selection on the gene

    • Perform QTL mapping using recombinant inbred line populations to identify natural allelic variants affecting phenotypes

  • Gene expression adaptation:

    • Study CBSDUFCH1 expression patterns across ecotypes from different environments

    • Identify potential regulatory adaptations in promoter regions

    • Analyze epigenetic modifications across environments

  • Integration with ecological data:

    • Conduct field experiments with wild-type and mutant plants

    • Assess performance under natural conditions

    • Examine competitive interactions in mixed populations

This comprehensive approach would provide insights into how CBSDUFCH1 contributes to plant adaptation across heterogeneous environments and potentially reveal its significance in plant evolution.

Sophisticated Research Methods for Studying CBSDUFCH1 Function

MethodApplicationAdvantagesLimitations
CRISPR/Cas9 gene editingGenerate precise mutations in specific domainsHighly specific, can create allelic seriesPotential off-target effects
IP-MS (Immunoprecipitation-Mass Spectrometry)Identify protein interaction partnersCaptures native complexesMay miss transient interactions
ChIP-seq (if transcription factor)Identify DNA binding sitesGenome-wide binding profileRequires specific antibodies
Proximity labeling (BioID/TurboID)Identify proteins in close proximityWorks for membrane proteins, captures transient interactionsMay label irrelevant neighboring proteins
PhosphoproteomicsIdentify phosphorylation changesGlobal view of signalingComplex data interpretation
CRISPR activation/interferenceModulate gene expressionMaintains native contextIncomplete activation/repression
Single-cell transcriptomicsCell-specific expression patternsHigh resolution of expressionTechnical challenges with plant cells
Cryo-EM structure determinationProtein structureHigh resolutionRequires protein purification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.