Recombinant Arabidopsis thaliana Putative glucuronosyltransferase PGSIP7 (PGSIP7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PGSIP7; At4g16600; dl4325w; FCAALL.404; Putative glucuronosyltransferase PGSIP7; Glycogenin-like protein 7; Plant glycogenin-like starch initiation protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PGSIP7
Target Protein Sequence
MDLQRTLMFSCWVLSLLIIKTTAYNEKQLFQPLETENANAMTAVMERGLKTQRRPEHKNA YATMMYMGTPRDYEFYVATRVLIRSLKSLHVDADIVVIASLDVPINWIHALEEEDGAKVV RVENLENPYKKQTNFDNRFKLSLNKLYAWSLSDYDRVVMLDVDNLFLKNTDELFQCGQFC AVFINPCIFHTGLFVLQPSMEVFRDMLHELEVKRDNPDGADQGFLVSYFSDLLNQPLFRP PPDNRTALKGHFRLPLGYQMDASYYYLKLRWNVPCGPNSVITFPGAVWLKPWYWWSWPVL PLGLSWHHQRRYTISYSAEMPWVLTQAVFYLGIILVTRLARPNMTKLCYRRSDKNLSMIQ TAFKFVALLFILSAYIIPFFIIPQTIHPLIGWSLYLTGSFALSTIPINAFLLPILPVITP WLGIFGTLLVMAFPSYPDGVVRALSVFGYAFCCAPFLWVSFVKITSHLQIMIDKEVLFPR LGESGVTSGLSKLY
Uniprot No.

Target Background

Database Links
Protein Families
Glycosyltransferase 8 family, Glycogenin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PGSIP7 and what is its role in Arabidopsis thaliana?

PGSIP7 (Plant glycogenin-like starch initiation protein 7), also known as Glycogenin-like protein 7, is a putative glucuronosyltransferase belonging to the GT8 glycosyltransferase family in Arabidopsis thaliana. It's classified as a GT8-glycogenin domain-containing protein with the enzyme commission number EC 2.4.1.- . While its precise function is still being fully characterized, it appears to be involved in cell wall biosynthesis processes, potentially playing a role in polysaccharide synthesis similar to other members of the GT8 family .

Unlike the well-characterized GUX proteins (GUX1, GUX2, GUX4) that have demonstrated xylan glucuronosyltransferase activity, PGSIP7's exact catalytic function remains under investigation . The protein contains multiple transmembrane domains, suggesting it is membrane-localized, likely in the Golgi apparatus where many cell wall polysaccharides are synthesized.

How does PGSIP7 relate to other members of the GT8 glycosyltransferase family?

The GT8 glycosyltransferase family in plants contains several distinct clades:

CladeExamplesKnown Functions
GUXGUX1-5Xylan glucuronosyltransferase activity
GolSGalactinol SynthaseGalactinol synthesis
GAUTGalacturonosyltransferaseHomogalacturonan synthesis
GATLGAUT-LikeCell wall polysaccharide synthesis
PGSIPPGSIP6-8Diverse/uncharacterized functions

PGSIP7 belongs to the PGSIP clade of GT8 proteins that includes PGSIP6, PGSIP7, and PGSIP8 in Arabidopsis . Unlike the GUX proteins that have a single N-terminal transmembrane domain, PGSIP7 has a distinct membrane topology with 5-7 predicted transmembrane domains according to the Aramemnon plant membrane protein database . This structural difference suggests potentially divergent functions from the better-characterized GUX proteins.

What are the gene and protein identifiers for PGSIP7?

The following table provides comprehensive identifiers for PGSIP7:

Identifier TypeValue
Gene NamePGSIP7
Locus TagAT4G16600
ORF NamesDL4325W, FCAALL.404
UniProt AccessionF4JMI5
Protein Alternative NamesPutative glucuronosyltransferase PGSIP7, Glycogenin-like protein 7, Plant glycogenin-like starch initiation protein 7, GT8-glycogenin domain-containing protein
EC Number2.4.1.-

These identifiers are essential for database searching and consistent identification in research publications .

How should recombinant PGSIP7 be stored to maintain activity?

Based on manufacturer recommendations, recombinant PGSIP7 should be stored following these guidelines:

  • Store at -20°C for routine storage

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles as this can compromise activity

  • Working aliquots can be maintained at 4°C for up to one week

  • The protein is typically provided in a liquid form containing glycerol or a Tris-based buffer with 50% glycerol

Proper storage is crucial for maintaining enzymatic activity, especially for glycosyltransferases which can be sensitive to denaturation during freeze-thaw cycles.

What expression systems are recommended for producing recombinant PGSIP7?

Several expression systems have been successfully used for PGSIP7 production:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, well-established protocolsMay lack post-translational modifications, potential for improper folding of membrane proteins
YeastEukaryotic processing, moderate yieldMore complex cultivation requirements
BaculovirusHigh-level expression, eukaryotic processingMore expensive, technically demanding
Mammalian CellNative-like folding and modificationsLowest yield, highest cost

For functional studies of glycosyltransferases, researchers have also successfully employed transient expression in Nicotiana benthamiana leaves using Agrobacterium-mediated transformation, which provides a plant-based expression system with appropriate post-translational modifications .

The choice of expression system should be guided by the specific research question, with E. coli being reported as a common host for PGSIP7 expression .

What assays can be used to measure PGSIP7 activity?

While specific assays for PGSIP7 are not described in the provided search results, typical methodologies for characterizing putative glycosyltransferases like PGSIP7 can be adapted from approaches used for related proteins:

  • Radiochemical assays: Using UDP-[14C]GlcA or other radiolabeled nucleotide sugars as donors to detect transfer to appropriate acceptors. This approach has been successful for characterizing GUX1 activity .

  • Enzyme-coupled spectrophotometric assays: Measuring the release of UDP during the glycosyltransferase reaction.

  • LC-MS analysis: For characterizing reaction products and determining linkage specificity, as demonstrated with other GT8 family proteins .

  • Complementation studies: Expressing PGSIP7 in mutant backgrounds lacking specific GT activities to assess functional complementation.

The choice of assay depends on the suspected donor/acceptor substrates and the research question being addressed.

How might the function of PGSIP7 be investigated using genetic approaches?

Genetic approaches to investigate PGSIP7 function might include:

  • T-DNA insertional mutants: Analyzing phenotypes of pgsip7 knockout lines for altered cell wall composition, development, or stress responses.

  • Overexpression lines: Generating plants overexpressing PGSIP7 to identify gain-of-function phenotypes.

  • Genome-wide association studies (GWAS): As demonstrated with other Arabidopsis genes, GWAS can identify genetic associations between PGSIP7 polymorphisms and phenotypic traits .

  • Comparative genomics: Analyzing PGSIP7 homologs across different plant species to infer conserved functions.

  • Expression pattern analysis: Using promoter-reporter constructs to determine tissue-specific expression patterns.

Genome-wide association studies in Arabidopsis have been particularly valuable in identifying genes involved in leaf microbial community structure and plant-environment interactions, which could be relevant for understanding PGSIP7 function in different ecological contexts .

How should experimental design be optimized when studying PGSIP7 expression or function?

When designing experiments to study PGSIP7, several considerations should be addressed:

  • Replication and randomization: Implementing proper experimental design with adequate replication and randomization to control for variability. For instance, complete block designs or incomplete block designs may be appropriate depending on the experimental context .

  • Appropriate controls: Including wild-type controls, empty vector controls for expression studies, and ideally complementation controls for mutant analyses.

  • Environmental conditions: Controlling growth conditions since Arabidopsis response to environmental variables can significantly influence gene expression and protein function .

  • Tissue specificity: Considering that PGSIP7 may have tissue-specific functions, experiments should include appropriate tissue sampling strategies.

  • Pooling considerations: When sample quantity is limited, pooling strategies may be employed, but should be carefully designed to maintain statistical power .

Design TypeApplicationAdvantage
Completely RandomizedSimple comparison of treatmentsNo blocking needed
Complete Block DesignWhen known sources of variation existControls for block effects
Incomplete Block DesignWhen block size is smaller than treatmentsMore flexible for complex experiments

For molecular studies, factorial designs are often preferable to one-factor-at-a-time approaches, allowing assessment of interactions between factors .

What are potential interactions between PGSIP7 and other cell wall biosynthetic pathways?

While specific interactions of PGSIP7 are not directly addressed in the provided materials, insights can be drawn from related glycosyltransferases:

  • Coordination with xylan biosynthesis: Given that other GT8 family members like GUX1/2/4 are involved in xylan glucuronosylation, PGSIP7 might function in related or complementary processes in polysaccharide biosynthesis .

  • Cell wall integrity pathways: Analysis of GWAS data from Arabidopsis has identified genes responsible for defense and cell wall integrity that affect microbial community variation, suggesting potential roles for cell wall-related proteins like PGSIP7 in plant-microbe interactions .

  • Spatial and temporal coordination: Like other cell wall biosynthetic enzymes, PGSIP7 likely operates within multi-protein complexes in the Golgi apparatus, with activity potentially coordinated with other enzymes in polysaccharide synthesis pathways.

  • Stress response integration: Environmental stresses affect Arabidopsis establishment and development, potentially altering expression patterns of cell wall-related genes including PGSIP7 .

Future research might employ co-expression analyses, protein-protein interaction studies, and conditional gene expression approaches to better understand these potential interactions.

What are the current knowledge gaps regarding PGSIP7 function?

Several important questions remain unanswered about PGSIP7:

  • Enzymatic activity: While PGSIP7 is classified as a putative glucuronosyltransferase, its specific donor and acceptor substrates remain unconfirmed, unlike the characterized GUX proteins .

  • Biological relevance: The physiological role of PGSIP7 in plant development, stress responses, or cell wall architecture requires further investigation.

  • Protein-protein interactions: Potential interactions with other cell wall biosynthetic enzymes or regulatory proteins have not been fully characterized.

  • Subcellular localization: Although predicted to be membrane-localized, detailed studies confirming its precise subcellular localization are needed.

  • Substrate specificity: The specificity and kinetic parameters of PGSIP7 activity have not been thoroughly explored.

These knowledge gaps present opportunities for future research to better understand the role of PGSIP7 in plant biology.

How might advances in computational approaches benefit PGSIP7 research?

Recent developments in computational biology offer significant opportunities for advancing PGSIP7 research:

  • AlphaFold2 and structural prediction: Protein structure prediction tools can generate structural models of PGSIP7 to infer functional properties and guide experimental design .

  • Integrative omics approaches: Combining different types of -omics data can help place PGSIP7 in broader biological contexts .

  • Machine learning for expression pattern prediction: ML approaches like convolutional neural networks can generate models to predict expression patterns across different tissues and conditions .

  • Natural language processing tools: Specialized AI tools trained on Arabidopsis literature can identify functional relationships between PGSIP7 and other biological entities .

The Arabidopsis research community has identified increased computational approaches as a key priority for future research, including improved techniques for integrating different omics datasets, modeling gene modifications, and understanding regulatory elements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.