Recombinant Arabidopsis thaliana Putative glucuronosyltransferase PGSIP8 (PGSIP8)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana Putative Glucuronosyltransferase PGSIP8 (PGSIP8) is a genetically engineered protein derived from the Arabidopsis thaliana gene At2g35710. Initially annotated as a starch initiation protein due to homology with glycogenin, PGSIP8 has been reclassified as a glucuronosyltransferase critical for xylan biosynthesis in plant cell walls . This enzyme belongs to Glycosyltransferase Family 8 (GT8) and plays a specialized role in secondary cell wall formation, impacting biomass composition and bioenergy research .

Gene and Protein Features

  • Gene Name: PGSIP8 (Plant Glycogenin-like Starch Initiation Protein 8)

  • Locus: At2g35710 (Chromosome 2)

  • UniProt ID: Q8VZP6

  • Protein Length: 497 amino acids

  • Domains: Predicted type II transmembrane protein with a GT8 catalytic domain .

Recombinant Production

Recombinant PGSIP8 is expressed in heterologous systems for functional studies:

Host SystemPurityTagApplications
E. coli≥90% (SDS-PAGE)His-tag Enzyme assays, structural studies
Yeast/Mammalian≥85% (SDS-PAGE)None Localization, activity screening

Enzymatic Activity

PGSIP8 (renamed GUX8 in some contexts) exhibits xylan α-glucuronosyltransferase activity:

  • Substrate Specificity: Transfers glucuronic acid (GlcA) from UDP-GlcA to β(1,4)-xylan backbones .

  • Acceptor Preference: Xylohexaose (6 xylose units) is the optimal acceptor, with GlcA added predominantly to the fifth xylose residue .

  • Kinetic Parameters:

    • KmK_m for UDP-GlcA: 165 µM

    • pH Optimum: 6.5–7.5

Cellular Role

  • Localization: Golgi apparatus, consistent with its role in cell wall polysaccharide synthesis .

  • Biological Impact:

    • Essential for glucuronoxylan substitution, which determines xylan’s interaction with cellulose and lignin in secondary cell walls .

    • Mutants show reduced xylan GlcA content, leading to compromised mechanical strength in stems .

Phylogenetic Classification

  • GT8 Family: Includes galacturonosyltransferases (GAUTs), galactinol synthases (GolS), and xylan-specific GUX clade members .

  • Key Homologs:

    • GUX1/GUX2: Active glucuronosyltransferases with similar acceptor specificity .

    • PGSIP6 (IPGT1): Divergent function in glycolipid synthesis .

Cell Wall Biosynthesis Studies

  • Used to elucidate mechanisms of xylan substitution patterns in Arabidopsis .

  • Key tool for engineering plants with modified biomass for biofuel production .

Protein Interaction Screens

  • Identified in complexes with xylan synthase (IRX10) and other GUX proteins, suggesting coordinated xylan synthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PGSIP8; At2g35710; T20F21.27; Putative glucuronosyltransferase PGSIP8; Glycogenin-like protein 8; Plant glycogenin-like starch initiation protein 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-497
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PGSIP8
Target Protein Sequence
MDLQRGFVFLSLVLSFMIIETTAYRERQLLLLQPPQETAIDTANAVVTVQDRGLKTRRPE HKNAYATMMYMGTPRDYEFYVATRVLIRSLRSLHVEADLVVIASLDVPLRWVQTLEEEDG AKVVRVENVDNPYRRQTNFNSRFKLTLNKLYAWALSDYDRVVMLDADNLFLKKADELFQC GRFCAVFINPCIFHTGLFVLQPSVEVFKDMLHELQVGRKNPDGADQGFLVSYFSDLLDQP LFSPPSNGSVLNGHLRLPLGYQMDASYFYLKLRWNIPCGPNSVITFPGAVWLKPWYWWSW PVLPLGFSWHEQRRATIGYSAEMPLVIIQAMFYLGIIVVTRLARPNITKLCYRRSDRNLT TIQAGFKLIALLSVVAAYIFPFFTIPHTIHPLIGWSLYLMASFALSSISINTLLLPTLPV LTPWLGILGTLLVMAFPWYPDGVVRALSVFAYAFCCAPFVWVSFRKITSHLQVLIEKEVL FPRLGDSGVTSGFSKLY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G35710

STRING: 3702.AT2G35710.1

UniGene: At.27134

Protein Families
Glycosyltransferase 8 family, Glycogenin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PGSIP8 and which protein family does it belong to?

PGSIP8 (Plant Glycogenin-like Starch Initiation Protein 8) is a putative glucuronosyltransferase from Arabidopsis thaliana that belongs to Glycosyltransferase Family 8 (GT8) according to the Carbohydrate Active Enzyme (CAZy) database. In Arabidopsis, GT8 contains several distinct clades including the GUX (glucuronosyltransferase) clade, Galactinol Synthase (GolS), Galacturonosyltransferase (GAUT), and GAUT-Like (GATL) clades. PGSIP8 is one of three GT8 proteins in Arabidopsis (along with PGSIP6 and PGSIP7) that do not belong to these major clades . Phylogenetic analyses indicate that PGSIP8 appears to be only distantly related to both the GUX and GolS clades within the GT8 family .

How is PGSIP8 structurally organized and what is its predicted membrane topology?

PGSIP8, unlike the GUX proteins which are type II membrane proteins with a single N-terminal transmembrane domain, has a more complex predicted membrane topology. According to analyses using the Aramemnon plant membrane protein database, PGSIP8 is predicted to have between five and seven transmembrane domains with scores above 0.5 . This multi-pass transmembrane topology distinguishes PGSIP proteins from other GT8 family members and may reflect differences in their subcellular localization and function within the endomembrane system.

What experimental systems are suitable for expressing recombinant PGSIP8?

Based on successful approaches with related glycosyltransferases, several expression systems can be employed for PGSIP8:

Expression SystemAdvantagesLimitationsApplication
Pichia pastorisPost-translational modifications, high yieldLonger production timeExpression of soluble catalytic domain
Nicotiana benthamianaPlant-specific modifications, transient expressionLower yield than yeastSubcellular localization studies
E. coliRapid production, simple purificationLacks glycosylationBasic protein production
Arabidopsis thalianaNative conditionsComplex purificationIn vivo functional studies

For subcellular localization studies, transient expression in Nicotiana benthamiana has proven effective for related proteins . For biochemical characterization, expressing the soluble catalytic domain in Pichia pastoris would be recommended, similar to the approach used for AtGlcAT14A .

What methods can be used to determine PGSIP8 subcellular localization?

For determining the subcellular localization of PGSIP8, researchers should consider:

  • Fluorescent protein fusion constructs (YFP or GFP) for confocal microscopy

  • Co-localization with known organelle markers (particularly Golgi markers)

  • Confocal laser-scanning microscopy with appropriate parameters:

    • Objective: 1.30 numerical aperture oil 40× objective

    • For YFP imaging: excitation/emission of 514/519 to 560 nm

    • For mCherry (as marker): excitation/emission of 587/600 to 634 nm

    • Image acquisition with software like Zen (Carl Zeiss)

When analyzing results, researchers should look for patterns consistent with Golgi localization, as related glycosyltransferases involved in cell wall biosynthesis typically localize to the Golgi apparatus .

How can researchers generate and validate PGSIP8 mutant lines?

To generate and properly validate PGSIP8 mutant lines:

  • Obtain T-DNA insertion lines from repositories (e.g., ABRC, NASC)

  • Confirm homozygosity through PCR genotyping using:

    • Gene-specific primers flanking the insertion site

    • T-DNA border primers paired with gene-specific primers

  • Verify the absence of transcript by RT-PCR or RNA gel blot analysis

  • Confirm protein absence through immunoblotting if antibodies are available

  • For functional complementation:

    • Clone the wild-type PGSIP8 coding sequence

    • Transform confirmed mutant lines with the construct

    • Verify restoration of the wild-type phenotype

Validation should include at least two independent allelic T-DNA insertion lines to ensure observed phenotypes are due to the specific gene disruption rather than background mutations .

What assays can be used to determine the enzymatic activity of PGSIP8?

Based on methods used for related glycosyltransferases, researchers should consider:

Assay TypeMethodologyData AnalysisControls
Radiometric assayIncubate recombinant protein with UDP-[14C]GlcA and potential acceptorsMeasure incorporation of radioactivityHeat-inactivated enzyme
LC-MS analysisReact purified protein with UDP-GlcA and oligosaccharide acceptorsIdentify mass shifts in productsReaction without enzyme
HPAEC-PAD analysisSeparate reaction products by anion exchangeIdentify product peaksKnown standards
NMR spectroscopyStructure determination of purified productsIdentify linkage type and positionChemically synthesized standards

For initial screening, using a range of potential oligosaccharide acceptors (β-1,6-galactooligosaccharides, β-1,3-galactooligosaccharides) with various degrees of polymerization would be advisable, as different glycosyltransferases show distinct preferences for acceptor length and structure .

How should researchers analyze the kinetic properties of PGSIP8?

To determine kinetic parameters of PGSIP8:

  • Express and purify the soluble catalytic domain

  • Perform activity assays with varying concentrations of:

    • UDP-GlcA (donor substrate): 0-1000 μM range

    • Selected oligosaccharide acceptors: 0-500 μM range

  • Measure initial reaction rates under optimal pH and temperature conditions

  • Analyze data using non-linear regression to determine:

    • Km for UDP-GlcA (expected range: 100-200 μM based on related enzymes)

    • Km for oligosaccharide acceptors

    • Vmax and kcat values

    • Catalytic efficiency (kcat/Km)

For comparative purposes, researchers should note that related enzymes like UDP-Xyl synthase have a Km of 190 μM for UDP-GlcA, while RGXT2 has a Km of 140 μM .

How can researchers model the structure of PGSIP8 and predict its active site?

For structural modeling of PGSIP8:

  • Use homology modeling servers like SWISS-MODEL with appropriate templates:

    • Glycogenin structure (PDB ID: 1LL2) has been used for related GUX proteins

    • Define the appropriate catalytic domain boundaries based on sequence alignments

  • Generate electrostatic surface models using:

    • PDB2PQR for preparing parameters

    • Adaptive Poisson-Boltzmann Solver software for calculating surface electrostatics

  • Identify putative catalytic residues by examining:

    • Conserved DXD motifs typical of glycosyltransferases

    • The DQG motif found in related GUX proteins (absent in GAUT/GATL clades)

    • The conserved glutamine residue (equivalent to Gln-164 in glycogenin) that may transiently attach to the substrate sugar

  • Analyze surface electrostatics to identify potential substrate binding regions:

    • Look for positively charged patches that might accommodate negatively charged substrates like UDP-GlcA

What bioinformatic approaches can help predict PGSIP8 function based on its sequence?

To predict PGSIP8 function bioinformatically:

  • Perform comprehensive sequence alignments with:

    • Known glycosyltransferases with established functions

    • Other members of GT8 family from Arabidopsis and other species

  • Identify conserved motifs and critical residues:

    • Look for GT8 family signatures

    • Identify residues known to be involved in donor/acceptor binding

  • Construct phylogenetic trees to establish evolutionary relationships:

    • Include proteins with known functions as references

    • Use maximum likelihood or Bayesian approaches for robust tree construction

  • Analyze gene co-expression networks:

    • Identify genes co-expressed with PGSIP8 across different conditions

    • Look for enrichment of specific biological processes or pathways

What plant phenotypes should researchers examine in PGSIP8 mutant lines?

Based on phenotypes observed in related glycosyltransferase mutants, researchers should systematically analyze:

  • Seedling growth parameters:

    • Measure hypocotyl and root elongation (as AtGlcAT14A mutants showed 20-35% enhanced cell elongation)

    • Quantify germination rates and seedling establishment

  • Cell wall composition:

    • Analyze monosaccharide composition by HPAEC-PAD

    • Quantify specific linkage types by methylation analysis

    • Look for changes in:

      • Glucuronic acid content

      • Galactose linkage patterns (3-, 6- and 3,6-linked)

      • Arabinose content (3-, 2- and 2,5-linked)

  • Plant development metrics:

    • Document growth rate, flowering time, and reproductive development

    • Measure biomass accumulation

    • Assess leaf morphology and number

  • Stress responses:

    • Test resistance to pathogens (particularly Botrytis cinerea)

    • Evaluate response to wounding

    • Assess tolerance to abiotic stresses

How can researchers analyze changes in cell wall structure in PGSIP8 mutants?

For comprehensive cell wall analysis in PGSIP8 mutants:

  • Compositional analysis:

    • Extract and fractionate cell wall material

    • Perform acid hydrolysis followed by HPAEC-PAD to quantify monosaccharides

    • Use specific antibodies to detect epitopes in cell wall polysaccharides

  • Linkage analysis:

    • Perform methylation analysis coupled with GC-MS

    • Quantify specific linkage types (look for changes in 3-, 6- and 3,6-linked galactose and arabinose linkages)

  • Structural characterization:

    • Extract and purify arabinogalactan (AG) from mutant and wild-type plants

    • Analyze GlcA substitution patterns on Gal-β-1,6-Gal and β-1,3-Gal structures

    • Use enzymatic digestion coupled with MALDI-TOF MS to determine structural differences

  • Imaging approaches:

    • Apply immunohistochemistry with glycan-specific antibodies

    • Use fluorescence microscopy to visualize specific cell wall components

    • Consider atomic force microscopy for nanoscale cell wall architecture

How should researchers analyze PGSIP8 expression patterns?

To comprehensively analyze PGSIP8 expression:

  • Transcriptional analysis:

    • Perform RNA gel blot analysis using gene-specific probes from the 3′ untranslated region

    • Quantify transcript levels by qRT-PCR under various conditions

    • Compare expression patterns following infection with pathogens (e.g., Botrytis cinerea) and mechanical damage

  • Promoter analysis:

    • Generate transgenic plants with the PGSIP8 promoter driving a reporter gene (e.g., GUS)

    • Perform histochemical staining to visualize tissue-specific expression patterns

    • Document expression during different developmental stages

  • Protein-level analysis:

    • Develop antibodies against PGSIP8 for immunoblotting

    • Quantify protein levels in different tissues and conditions

    • Correlate protein abundance with transcript levels

  • Public database mining:

    • Analyze microarray and RNA-seq data from repositories

    • Examine expression patterns across tissues, developmental stages, and stress conditions

    • Identify potential transcription factors regulating PGSIP8

What techniques can be used to overexpress PGSIP8 in Arabidopsis for functional studies?

For effective PGSIP8 overexpression:

  • Construct design:

    • Clone the full PGSIP8 coding sequence into plant expression vectors

    • Use constitutive promoters (35S) for broad expression or tissue-specific promoters for targeted studies

    • Consider epitope tags (HA, FLAG) or fluorescent protein fusions for detection

  • Transformation methods:

    • Utilize Agrobacterium-mediated floral dip transformation

    • Select transformants on appropriate antibiotics

    • Verify transgene integration by PCR

  • Expression validation:

    • Confirm overexpression by RT-PCR, qRT-PCR, and Western blotting

    • Quantify the level of overexpression compared to wild-type

    • Select multiple independent transgenic lines with varying expression levels

  • Phenotypic analysis:

    • Compare growth parameters with wild-type controls

    • Look for morphological differences

    • Analyze cell wall composition

    • Test for altered stress responses

How can researchers investigate PGSIP8 protein-protein interactions?

To identify and characterize PGSIP8 protein interactors:

TechniqueApplicationAdvantagesConsiderations
Yeast two-hybridScreen for binary interactionsHigh-throughput, in vivoMay yield false positives/negatives
Split-ubiquitin systemMembrane protein interactionsSuitable for membrane proteinsMore complex than Y2H
Co-immunoprecipitationVerify interactions in plantaDetects native complexesRequires good antibodies
BiFCVisualize interactions in plant cellsShows interaction locationCannot detect dynamic interactions
FRET-FLIMQuantify interaction strengthHigh sensitivityTechnically challenging
Pull-down assaysIn vitro interaction verificationControlled conditionsMay not reflect in vivo reality

When designing experiments, consider that PGSIP8 might interact with:

  • Other glycosyltransferases in biosynthetic complexes

  • Proteins involved in substrate transport

  • Regulatory proteins

What methods are appropriate for studying the impact of PGSIP8 on cell wall dynamics?

For investigating PGSIP8's role in cell wall biosynthesis and remodeling:

  • Live cell imaging:

    • Generate PGSIP8-fluorescent protein fusions

    • Use spinning disk confocal microscopy for real-time imaging

    • Track protein dynamics during cell elongation and stress responses

  • Pulse-chase experiments:

    • Feed plants with isotopically labeled sugar precursors

    • Track incorporation into cell wall polysaccharides

    • Compare dynamics between wild-type and mutant plants

  • Cell wall mechanical properties:

    • Measure elastic modulus using atomic force microscopy

    • Compare tensile strength between wild-type and mutant tissues

    • Analyze cell wall extensibility during growth

  • In situ enzyme activity:

    • Develop activity-based protein profiling probes

    • Visualize active enzymes in intact tissues

    • Compare enzyme activities between genotypes during development

What are the most promising research directions for understanding PGSIP8 function?

Future research on PGSIP8 should focus on:

  • Precise biochemical characterization:

    • Determine donor and acceptor substrate specificity

    • Elucidate the exact linkage formed by PGSIP8

    • Resolve the three-dimensional structure

  • Systems biology approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Develop network models of cell wall biosynthesis incorporating PGSIP8

    • Apply machine learning to predict function based on phenotypic data

  • Evolutionary perspectives:

    • Compare PGSIP8 function across plant species

    • Investigate the evolutionary history of the GT8 family

    • Identify functional conservation and divergence

  • Biotechnological applications:

    • Explore potential for modifying cell wall properties for bioenergy applications

    • Investigate impact on plant stress resilience

    • Consider synthetic biology approaches to engineer novel cell wall structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.