Recombinant Arabidopsis thaliana Putative magnesium transporter MRS2-9 (MRS2-9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize developing the specified tag.
Synonyms
MRS2-9; At5g09710; F17I14.100; MTH16.16; Putative magnesium transporter MRS2-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-9
Target Protein Sequence
MSIDSDVDPSEVSTAKRKPSRSWLLIDAAGNSTMLNVDSYAIIRRVHIYARDLRVFESSI SSPLSIRTREGAIVLNLEHIKVIITADEVLLREPLNENVIPVAKEFERRLGVENRERRGQ PDGKEDSGAEVDAEKDESPFEFRALEVALEAICSFLAARTTELEKSGYPALNELASKISN RNFGKVHKLKISMLTVRVQKVKDELQLWLEDDDDLGDLCLSRKIATTSSPVSDSDEQINS YPTSPTIGAKISRAKSHLVRSATVRGDDQNDVEEVEMLLEAHYMQIDRTLNKLAELREYL DDTEDYINFQLASSRNKLIEFEVIITAGSVCISVYSLVVGILSTNIPFSWNTKEHMFKWV VSATATLCAIFFVIIISYARYKKLVGN
Uniprot No.

Target Background

Function
Putative magnesium transporter.
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the MRS2/MGT gene family and how is MRS2-9 classified within it?

The MRS2/MGT gene family in Arabidopsis thaliana belongs to the superfamily of CorA-MRS2-ALR-type membrane proteins characterized by a conserved GMN tripeptide motif (Gly-Met-Asn) at the end of the first of two C-terminal transmembrane domains. These proteins function as magnesium transporters. Within this family, MRS2-9 has been identified as a pseudogene , indicating it may lack protein-coding functionality despite sequence similarity to other family members. The MRS2/MGT family in Arabidopsis is organized into five distinct clades (A through E) based on evolutionary relationships and intron insertion sites .

What structural features characterize the MRS2/MGT transporters in Arabidopsis?

MRS2/MGT proteins typically contain two transmembrane domains in the C-terminal region and the characteristic GMN motif essential for magnesium transport activity. While specific structural information for MRS2-9 is limited due to its pseudogene status, other family members share these conserved domains. Functional MRS2 proteins form pentameric structures in the membrane, creating a pore for selective magnesium ion transport. These proteins exhibit variable motif compositions, with some motifs being conserved across all members while others are clade-specific or absent in certain members .

Where is MRS2-9 expressed in Arabidopsis tissues?

While MRS2-9 is classified as a pseudogene and therefore unlikely to have significant expression , other MRS2/MGT family members show distinct tissue-specific expression patterns. For example, MRS2-1 and MRS2-5 show strong expression in early seedling development and later become more localized to vascular tissues of expanded cotyledons. In contrast, MRS2-10 is highly localized to hydathodes of cotyledons and the epicotyl, while MRS2-7 expression is entirely restricted to the root at the seedling stage . This diverse expression pattern suggests specialized roles for different family members in magnesium homeostasis throughout the plant.

What methods are commonly used to study the function of MRS2/MGT transporters?

Researchers typically employ several complementary approaches to study MRS2/MGT transporters:

  • Heterologous expression systems: Expressing Arabidopsis MRS2 genes in yeast or bacterial mutants deficient in magnesium transport to test for functional complementation .

  • T-DNA insertion knockout lines: Creating single, double, or triple knockout lines to observe phenotypes under various magnesium conditions .

  • Subcellular localization studies: Using fluorescent protein fusions to determine the membrane localization of transporters .

  • X-ray microanalysis: Analyzing cell-specific vacuolar elemental profiles to determine magnesium distribution across different cell types .

  • Expression analysis: Using techniques like RT-PCR, qPCR, and microarray analysis to determine tissue-specific expression patterns .

How do you determine if MRS2-9 is truly a pseudogene rather than a functional gene with specialized expression?

To definitively classify MRS2-9 as a pseudogene requires a multi-faceted approach:

  • Sequence analysis: Identify disruptions in the coding sequence such as premature stop codons, frameshift mutations, or corrupted splice sites that would prevent functional protein production.

  • Transcriptional analysis: Employ RNA-seq and RT-PCR across multiple tissues and conditions to determine if any transcript is produced.

  • Promoter activity assays: Create promoter-reporter constructs to assess if the gene's regulatory elements remain active despite pseudogene status.

  • Evolutionary analysis: Compare with orthologs in related species to determine when pseudogenization might have occurred.

  • Complementation experiments: Attempt to express the gene in heterologous systems like the Salmonella MM281, as done with functional family members MRS2-1, MRS2-4, and MRS2-7, to confirm lack of transport activity .

  • CRISPR-mediated repair: Attempt to restore the potentially corrupted sequence to determine if function can be recovered, which would support its classification as a pseudogene.

How does magnesium concentration in different cellular compartments affect plant growth under varying environmental conditions?

Magnesium compartmentalization is crucial for plant growth, particularly under stress conditions:

  • Vacuolar storage: Mesophyll cells accumulate the highest vacuolar concentration of magnesium in Arabidopsis leaves, with MRS2-1/MGT2 and MRS2-5/MGT3 playing important roles in this compartmentalization . The vacuole serves as a reservoir for magnesium, releasing it when cytosolic concentrations decrease.

  • Low calcium adaptation: Under serpentine (low calcium) conditions, magnesium accumulation becomes particularly important. Research has shown that magnesium can act as a key osmoticum required to maintain growth in low calcium concentrations . This is evidenced by perturbed mesophyll-specific vacuolar magnesium accumulation in MRS2-1 and MRS2-5 T-DNA insertion lines under serpentine conditions .

  • Compensatory mechanisms: Experimental data from triple knockout lines (mrs2-1/5/10) indicate that detrimental effects of low Mg²⁺ can be ameliorated when Ca²⁺ concentrations are concomitantly lowered . This suggests an important interplay between these two most abundant divalent cations in plant nutrient homeostasis.

What are the experimental challenges in characterizing magnesium transport activity of recombinant MRS2 proteins?

Several methodological challenges need to be addressed when studying recombinant MRS2 proteins:

  • Protein expression issues: Membrane proteins are often difficult to express in heterologous systems at sufficient levels for biochemical analysis. Optimizing expression conditions is critical.

  • Functional redundancy: The MRS2/MGT family shows significant functional redundancy, which complicates phenotypic analysis of single knockout mutants. Multiple knockouts of MRS2-1, MRS2-5, and MRS2-10 were necessary to observe clear magnesium deficiency phenotypes .

  • Transport assay limitations: Direct measurement of Mg²⁺ transport is technically challenging. Advanced methods like mag-fura-2 fluorescence assays have been developed to directly measure magnesium uptake .

  • Physiological relevance: Connecting in vitro transport activity to in planta function requires careful experimental design, including:

    • Using physiologically relevant magnesium concentrations

    • Accounting for the influence of other cations

    • Creating appropriate controls for membrane potential effects

  • Subcellular targeting: Ensuring proper targeting of recombinant proteins to the correct membrane requires optimization of targeting sequences and verification of localization.

How do multiple knockout lines of MRS2 genes affect magnesium homeostasis compared to single gene knockouts?

The creation of multiple knockout lines has revealed critical insights about functional redundancy within the MRS2/MGT family:

Knockout LinePhenotype Under Standard Mg²⁺Phenotype Under Low Mg²⁺Reference
mrs2-1 (single)No significant phenotypeNo significant phenotype
mrs2-5 (single)No significant phenotypeNo significant phenotype
mrs2-10 (single)No significant phenotypeNo significant phenotype
mrs2-1/5 (double)No significant phenotypeNo significant phenotype
mrs2-5/10 (double)No significant phenotypeNo significant phenotype
mrs2-1/10 (double)Viable but wilting earlySevere developmental retardation
mrs2-1/5/10 (triple)Viable but wilting earlySevere developmental retardation

These results indicate that MRS2-1, MRS2-5, and MRS2-10 have overlapping functions despite their different expression patterns. The phenotypes of double and triple knockouts become apparent only under limiting magnesium conditions, suggesting that plants maintain multiple redundant systems for magnesium homeostasis . Interestingly, the growth retardation phenotypes seen upon hydroponic cultivation under low Mg²⁺ could be ameliorated when Ca²⁺ concentrations were concomitantly lowered, supporting the notion of an important interplay between these two most abundant divalent cations .

What expression systems are most effective for producing recombinant MRS2 proteins for functional studies?

For functional studies of recombinant MRS2 proteins, several expression systems have proven effective:

  • Yeast expression: The Saccharomyces cerevisiae mrs2 mutant has been successfully used to test complementation by Arabidopsis MRS2 genes. This system allows for targeting of the recombinant proteins to yeast mitochondria using the native yeast Mrs2p mitochondrial targeting sequence . The complementation can be monitored by restoration of growth on non-fermentable medium with glycerol (YPdG).

  • Bacterial expression: The Salmonella typhimurium mutant MM281, which lacks three major Mg²⁺ transport systems, has been used to test MRS2 function. This system requires subcloning of the coding regions into vectors like pTrc99A . Functional complementation is assessed by growth recovery on medium with low magnesium concentrations (0.01 mM Mg²⁺).

  • Plant expression: For in planta studies, Agrobacterium-mediated transformation of Arabidopsis can be used to express recombinant MRS2 proteins fused with fluorescent tags for localization studies or for complementation of knockout lines.

The choice of expression system depends on the specific research questions being addressed. For basic transport function, bacterial or yeast systems are preferred due to their simplicity, while in planta expression is essential for investigating physiological roles and protein interactions.

How can researchers accurately measure magnesium transport activity in different cellular compartments?

Accurate measurement of magnesium transport requires specialized techniques for different cellular compartments:

  • Cytosolic measurements:

    • Mag-fura-2 fluorescent dye can be used to measure free cytosolic Mg²⁺ concentrations in protoplasts or cell culture

    • MagGreen-AM is another fluorescent probe useful for cytosolic measurements

  • Mitochondrial measurements:

    • The mag-fura-2 system has been established for direct measurement of Mg²⁺ uptake into mitochondria of Saccharomyces cerevisiae

    • Mitochondrial targeting of magnesium-sensitive fluorescent proteins

  • Vacuolar measurements:

    • X-ray microanalysis of vacuolar elemental profiles to determine magnesium concentration in different cell types

    • Vacuole isolation and ion content analysis using ICP-MS (Inductively Coupled Plasma Mass Spectrometry)

  • Whole plant and tissue analysis:

    • ICP-MS or ICP-OES (Optical Emission Spectrometry) for total tissue magnesium content

    • Radioactive ²⁸Mg²⁺ tracer studies to follow transport kinetics between tissues

  • In vitro transport assays:

    • Reconstitution of purified transporters into liposomes loaded with fluorescent magnesium indicators

    • Patch-clamp electrophysiology for direct measurement of magnesium currents

What are the optimal conditions for studying magnesium deficiency phenotypes in MRS2 knockout lines?

Based on research with multiple MRS2 knockout lines, the following experimental conditions are optimal for studying magnesium deficiency phenotypes:

  • Growth medium composition:

    • Standard MS medium typically contains 1.5 mM MgSO₄

    • For deficiency studies, reduce Mg²⁺ concentration to 50 μM or less

    • Consider manipulating Ca²⁺ levels simultaneously, as Ca²⁺/Mg²⁺ ratio affects phenotypes

  • Growth system:

    • Small-scale liquid culturing system in 24-well plates allows economical testing of multiple conditions

    • Hydroponic systems provide precise control of nutrient availability

    • Serpentine soil conditions (high Mg²⁺, low Ca²⁺) can reveal specialized adaptations

  • Phenotypic parameters to monitor:

    • Germination rate and timing

    • Root development (primary root length, lateral root formation)

    • Shoot development and chlorophyll content

    • Biomass accumulation

    • Leaf ionome composition using ICP-MS

  • Experimental design considerations:

    • Include appropriate wild-type controls and single knockout controls

    • Track developmental stages systematically

    • Maintain consistent light, temperature, and humidity conditions

    • Consider testing multiple ecotypes, as natural variation in magnesium efficiency exists

How can researchers differentiate between the roles of different MRS2 family members in magnesium transport?

Differentiating the roles of MRS2 family members requires a multi-faceted approach:

  • Expression pattern analysis:

    • Tissue-specific expression using reporter genes (GUS, GFP) fused to promoters

    • Cell-type specific expression through FACS sorting and RNA-seq

    • Developmental stage analysis to identify temporal regulation

  • Subcellular localization:

    • Fluorescent protein fusions and confocal microscopy to determine membrane targeting

    • Co-localization with organelle markers

    • Biochemical fractionation and Western blotting

  • Genetic approaches:

    • Progressive construction of multiple knockout lines (double, triple mutants)

    • CRISPR/Cas9 gene editing for precise mutations

    • Complementation of knockout lines with specific family members

  • Transport characteristics:

    • Kinetic parameters (Km, Vmax) in heterologous systems

    • Inhibitor sensitivity profiles

    • Selectivity for Mg²⁺ versus other divalent cations

    • Response to regulatory factors

  • Physiological context:

    • Response to varying external Mg²⁺ concentrations

    • Adaptation to stress conditions (drought, salinity)

    • Interaction with other nutrient transport systems

    • Role in specific physiological processes (photosynthesis, growth, reproduction)

How can understanding MRS2 transporters contribute to improving plant nutrient efficiency in agricultural settings?

Knowledge of MRS2 transporters has several potential applications for agricultural improvement:

  • Crop breeding strategies:

    • Selection for optimal MRS2 alleles in crop breeding programs can enhance magnesium use efficiency

    • Natural variation in MRS2 genes across ecotypes provides genetic material for breeding

    • Expression analysis of 23 Arabidopsis ecotypes varying in leaf magnesium concentrations has revealed correlations between MRS2 expression and magnesium accumulation

  • Adaptation to problematic soils:

    • MRS2 transporters enable adaptation to serpentine soils (high Mg²⁺, low Ca²⁺)

    • Understanding Mg²⁺/Ca²⁺ interactions can help develop crops for calcareous or magnesium-deficient soils

    • MRS2-mediated mechanisms may improve plant performance on marginal lands

  • Biofortification applications:

    • Optimizing magnesium content in edible plant tissues through MRS2 engineering

    • Enhanced magnesium accumulation in specific tissues may improve nutritional quality

  • Stress tolerance:

    • Magnesium homeostasis affects photosynthetic efficiency and energy metabolism

    • MRS2-mediated magnesium compartmentalization may enhance tolerance to abiotic stresses

What experimental approaches would be most effective for investigating potential interactions between MRS2-9 pseudogene sequences and functional MRS2 genes?

Despite MRS2-9 being a pseudogene, investigating its potential interactions with functional MRS2 genes could reveal important regulatory mechanisms:

  • Transcriptional interference studies:

    • Analyze if MRS2-9 transcription (even if non-coding) affects expression of nearby genes

    • Investigate shared regulatory elements between MRS2-9 and functional MRS2 genes

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factor binding

  • Non-coding RNA analysis:

    • Determine if MRS2-9 produces non-coding RNAs that could regulate other MRS2 genes

    • Perform RNA immunoprecipitation to identify potential RNA-protein interactions

    • Investigate if pseudogene-derived small RNAs might target functional MRS2 mRNAs

  • Genetic modification approaches:

    • Complete deletion of the MRS2-9 locus to observe effects on other MRS2 genes

    • Targeted mutagenesis of specific MRS2-9 elements to identify functional regions

    • Overexpression of MRS2-9 pseudogene sequences to test for dominant negative effects

  • Evolutionary analysis:

    • Compare MRS2-9 sequences across related species to identify conserved elements

    • Reconstruct the ancestral sequence to understand the pseudogenization process

    • Identify selective pressures acting on the MRS2-9 locus

What are the most promising techniques for visualizing magnesium transport dynamics in living plant cells?

Advanced imaging techniques are transforming our ability to study magnesium transport in living cells:

  • Genetically encoded magnesium sensors:

    • FRET-based magnesium sensors can be targeted to specific organelles

    • MagFRET and similar constructs allow real-time monitoring of magnesium fluctuations

    • Can be expressed under tissue-specific promoters for in vivo imaging

  • Chemical probes with subcellular targeting:

    • Mag-fura-2 and derivatives with organelle-targeting sequences

    • Cell-permeant dyes like Magnesium Green-AM for cytosolic measurements

    • Compartment-specific dye loading techniques

  • Combined imaging approaches:

    • Simultaneous imaging of magnesium sensors and fluorescently tagged MRS2 transporters

    • Correlative light and electron microscopy to link transport activity with ultrastructure

    • Multi-parameter imaging to correlate magnesium dynamics with pH, membrane potential, or calcium

  • Advanced microscopy platforms:

    • Light sheet microscopy for whole-seedling imaging with minimal phototoxicity

    • Super-resolution microscopy to visualize transporter clustering and organization

    • Microfluidic devices coupled with imaging for controlled perturbation experiments

  • Elemental mapping techniques:

    • Synchrotron X-ray fluorescence microscopy for high-resolution elemental mapping

    • NanoSIMS (Nanoscale Secondary Ion Mass Spectrometry) for subcellular elemental analysis

    • Cryo-electron microscopy of vitrified tissue sections with elemental analysis

How might comparative genomics approaches across plant species enhance our understanding of MRS2 transporter evolution and function?

Comparative genomics offers valuable insights into MRS2 transporter evolution:

  • Evolutionary trajectory analysis:

    • Tracking the expansion of the MRS2 family across plant lineages from algae to angiosperms

    • Identifying selective pressures on different MRS2 clades

    • Understanding pseudogenization events like MRS2-9 in an evolutionary context

  • Structure-function relationships:

    • Correlating sequence conservation with functional domains

    • Identifying clade-specific sequence motifs that might confer specialized functions

    • Reconstructing ancestral MRS2 proteins to understand functional innovations

  • Regulatory element analysis:

    • Comparing promoter architecture across species to identify conserved regulatory modules

    • Tracking evolution of expression patterns through comparative transcriptomics

    • Identifying lineage-specific regulatory innovations

  • Species adaptation studies:

    • Investigating MRS2 adaptations in plants from magnesium-limited environments

    • Comparing serpentine-adapted and non-adapted species/ecotypes

    • Functional testing of MRS2 orthologs from diverse species, as has been done with banana MaMRS2 genes

What role might MRS2 transporters play in plant responses to abiotic stresses beyond magnesium deficiency?

MRS2 transporters likely have broader roles in stress adaptation:

  • Drought stress:

    • Magnesium is critical for photosynthetic efficiency under water limitation

    • MRS2-mediated vacuolar magnesium storage may contribute to osmotic adjustment

    • Vacuolar magnesium pools could serve as buffers during periods of limited uptake

  • Salt stress:

    • High sodium levels compete with magnesium uptake and displacement from binding sites

    • MRS2 transporters may be regulated to maintain magnesium homeostasis under saline conditions

    • Vacuolar compartmentalization may protect cytosolic processes from ion imbalance

  • Temperature stress:

    • Magnesium stabilizes membranes and protein structures under temperature extremes

    • Photosynthetic acclimation to temperature requires magnesium-dependent adjustments

    • MRS2-mediated magnesium partitioning may contribute to cold or heat tolerance

  • Oxidative stress:

    • Magnesium is required for antioxidant enzyme function

    • Proper chloroplast magnesium levels prevent excessive ROS production

    • MRS2 transporters might be regulated as part of oxidative stress responses

How do MRS2 transporters coordinate with other ion transport systems to maintain cellular ion homeostasis?

MRS2 transporters function within a complex network of ion transport systems:

  • Calcium-magnesium interactions:

    • Research has demonstrated that low calcium can ameliorate magnesium deficiency phenotypes in mrs2 mutants

    • This suggests coordinated regulation between calcium and magnesium transport systems

    • Potential crosstalk between MRS2 transporters and calcium channels/transporters

  • Proton coupling mechanisms:

    • Magnesium transport may be influenced by pH gradients across membranes

    • Coordination with proton pumps and pH regulation systems

    • The influence of membrane potential on MRS2 transport activity

  • Regulatory networks:

    • Transcriptional coordination of multiple transporter families

    • Post-translational modifications affecting multiple transport systems

    • Shared sensing and signaling components

  • Physical interactions:

    • Potential for direct protein-protein interactions between transporters

    • Formation of transport complexes with multiple ion specificities

    • Membrane microdomain organization of transport machinery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.