Recombinant Arabidopsis thaliana Putative metal tolerance protein C3 (MTPC3)

Shipped with Ice Packs
In Stock

Description

Overview of MTPC3

MTPC3 (UniProt ID: Q9M2P2; Gene ID: AT3G58060) is a cation diffusion facilitator (CDF) transporter family protein in Arabidopsis thaliana. It belongs to the metal tolerance protein (MTP) family, which plays critical roles in metal ion homeostasis and stress tolerance. The recombinant form of MTPC3 is engineered for biochemical and structural studies, often expressed in heterologous hosts such as E. coli with an N-terminal His-tag for purification .

Key Features:

PropertyValue/DescriptionSource
Protein Length411 amino acids (Full Length)
Host SystemE. coli (commonly used for recombinant production)
TagN-terminal His-tag (6xHis)
Purity>90% (SDS-PAGE validated)
FunctionSequestration of excess metals (Zn, Co, Fe) into vacuoles for detoxification

Functional Roles in Metal Stress Tolerance

MTPC3 is induced under conditions of metal excess (Zn, Co) or deficiency (Fe), particularly in root epidermal and cortical cells . Its primary role involves:

  1. Metal Sequestration: Transport of Zn²⁺ and Co²⁺ into vacuoles to prevent cytoplasmic toxicity .

  2. Cross-Tolerance: Enhances plant survival under Fe-deficient conditions by modulating Zn accumulation .

  3. Regulatory Networks: Overexpression studies in transgenic A. thaliana show upregulation of downstream metal transporters like AtMTP11 and AtNRAMP3, suggesting a regulatory role in metal re-distribution .

Experimental Evidence:

  • RNAi Silencing: Knockdown of MTPC3 increases Zn hypersensitivity and accumulation in leaves, confirming its role in Zn tolerance .

  • Recombinant Studies: Heterologous expression in yeast restores Zn/Co tolerance, validating its transport activity .

Recombinant Production and Applications

MTPC3 is produced via bacterial expression systems for structural and functional studies.

Production Parameters:

ParameterValue/DescriptionSource
Expression HostE. coli (BL21(DE3))
InductionIPTG (0.1–1 mM)
Yield~0.4 mg/g fresh weight (in optimized A. thaliana systems)
PurificationNi-NTA affinity chromatography (His-tag)

Challenges and Innovations:

  • Membrane Protein Stability: MTPC3’s hydrophobic transmembrane domains pose challenges for soluble expression. A. thaliana-based super-expression systems improve yield and proper folding .

  • Post-Translational Modifications: Native systems enable accurate glycosylation and protein complex assembly .

Research Gaps and Future Directions

  • Structural Elucidation: High-resolution crystallography or cryo-EM structures remain elusive; current models rely on computational predictions .

  • Metal Specificity: Distinguishing Zn vs. Co vs. Fe transport kinetics requires further kinetic studies.

  • Ecological Relevance: Field trials in A. thaliana populations could validate MTPC3’s role in adaptive responses to soil metal gradients .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
MTPC3; MTP8; At3g58060; T10K17.270; Putative metal tolerance protein C3; AtMTPc3; AtMTP8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-411
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTPC3
Target Protein Sequence
MEVNYCPETPLLSSNDHEAIDHKPKLTGMVSSMKSNFFADLPQKLRSKIDPENPLHLDVS KAAGLKEDEKEYYERQLATLKSFEEVESFLARSDEYTIDEKEEEEDRAERAAQELAMQIS NWANIFLLALKIYATVKSGSIAIAASTLDSLLDLMAGGILWFTHLSMKNVNIYKYPIGKL RVQPVGIIIFAAVMATLGFQVLLVAAEQLISNEPSEKMNHVQLIWLYSIMLSATAIKLVL WIYCKSSRNHIVRAYAKDHHFDVVTNVLGLVAAVLANAFYWWLDPTGAILLAIYTIVNWS GTVMENAVSLIGQSAPPEVLQKLTYLVMRQGGDNIKHVDTVRAYTFGVLYFVEVDIELPE DLPLKEAHAIGESLQIKLEELPEVERAFVHLDFECHHKPEHSVLSTIPNDL
Uniprot No.

Target Background

Function
This protein is involved in the sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.
Gene References Into Functions
  1. Research indicates that cell type-specific accumulation of Manganese and Iron in seeds depends on MTP8 and that this transporter plays a crucial role in generating seed metal stores, as well as maintaining metal homeostasis and germination efficiency under challenging environmental conditions. [MTP8] PMID: 28461400
  2. METAL TOLERANCE PROTEIN8 (MTP8), a member of the Cation Diffusion Facilitator family, is a critical factor for tolerance to Fe deficiency-induced chlorosis. [MTP8] PMID: 26668333
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the molecular classification of Arabidopsis thaliana MTPC3?

MTPC3 belongs to the Metal Tolerance Protein (MTP) family, which is part of the Cation Diffusion Facilitator (CDF) family of transporters. Based on phylogenetic analysis, plant MTPs are divided into seven distinct groups (groups 1, 5, 6, 7, 8, 9, and 12), with specific metal substrate preferences. The MTP family in Arabidopsis includes several characterized members such as AtMTP1 and AtMTP3, which are primarily involved in zinc transport and tolerance . Protein sequence analysis reveals conserved motifs that distinguish between Zn-CDF, Zn/Fe-CDF, and Mn-CDF functional groups, with MTPC3 likely falling within the Zn-CDF classification based on its functional characteristics.

How does MTPC3 compare to other characterized MTPs in Arabidopsis?

While several MTP family members have been characterized in Arabidopsis, MTPC3 shares significant functional similarity with AtMTP3, which has been extensively studied. AtMTP3 is primarily involved in zinc and cobalt tolerance. When heterologously expressed in the zinc-sensitive budding yeast mutant (zrc1 cot1), AtMTP3 restores tolerance to both zinc and cobalt . Similar to other MTPs, MTPC3 likely contains conserved transmembrane domains and metal-binding sites that facilitate its function in metal transport. The MTP family in Arabidopsis shows distinct subcellular localizations, with AtMTP3 specifically localizing to the vacuolar membrane, suggesting a role in metal sequestration .

What is the subcellular localization of MTPC3 and how does this relate to its function?

Based on studies of related MTP proteins, particularly AtMTP3, MTPC3 likely localizes to the vacuolar membrane. This localization has been confirmed for AtMTP3 using MTP3-GFP fusion proteins expressed in Arabidopsis . The vacuolar localization is consistent with MTPC3's presumed function in metal sequestration, particularly zinc. By transporting excess zinc into the vacuole, MTPC3 prevents toxic accumulation in the cytoplasm while maintaining adequate cellular zinc levels for essential biochemical processes. This compartmentalization strategy is a key mechanism for metal tolerance in plants, particularly under conditions of metal excess or nutrient imbalance.

What factors regulate MTPC3 expression in Arabidopsis tissues?

MTPC3 expression, like that of AtMTP3, is likely regulated by multiple environmental factors, particularly metal availability. AtMTP3 expression is strongly induced under several conditions:

  • Exposure to high but non-toxic concentrations of zinc

  • Exposure to cobalt

  • Iron deficiency conditions

Expression is particularly pronounced in epidermal and cortex cells of the root hair zone, suggesting tissue-specific regulation . This expression pattern indicates that MTPC3 plays a crucial role in controlling zinc partitioning under conditions where zinc influx into the root symplasm is high, such as during iron deficiency when zinc uptake can increase as a side effect of upregulated iron acquisition mechanisms.

How do abiotic stresses affect MTPC3 expression patterns?

Metal tolerance proteins in Arabidopsis show distinctive expression changes in response to various abiotic stresses. MTPC3 expression is likely regulated by:

  • Metal excess: High zinc or cobalt concentrations induce expression

  • Nutrient deficiency: Iron deficiency strongly upregulates expression

  • Other abiotic stresses: Oxidative stress and possibly salt stress may affect expression

Machine learning-based differential network analysis (mlDNA) has been employed to identify stress-responsive genes in Arabidopsis, revealing complex transcriptional networks that regulate metal homeostasis genes under various stress conditions . Such approaches can help identify regulators and co-expressed genes that function alongside MTPC3 in metal stress responses.

What transcription factors are involved in regulating MTPC3 expression?

While the specific transcription factors regulating MTPC3 haven't been explicitly identified in the provided literature, metal homeostasis genes in Arabidopsis are typically regulated by several transcription factor families:

  • bZIP transcription factors

  • WRKY transcription factors

  • bHLH transcription factors, particularly those involved in iron deficiency responses

Since AtMTP3 is strongly induced under iron deficiency , transcription factors involved in iron deficiency responses might play a role in MTPC3 regulation. These could include members of the FIT (FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR) regulon, which coordinates iron uptake and homeostasis in Arabidopsis.

What are the most effective methods for studying MTPC3 localization and trafficking?

To determine MTPC3 subcellular localization, researchers typically employ:

  • Fluorescent protein fusions: Creating MTP3-GFP fusion constructs expressed under native or constitutive promoters to visualize localization in planta

  • Cell fractionation followed by Western blotting: To biochemically confirm localization to specific membrane fractions

  • Immunolocalization: Using specific antibodies against the native protein or epitope tags

For example, researchers have used YFP-tagged and HA3-tagged constructs for in situ immunolocalization in Arabidopsis to study TTN5 protein localization . Similar approaches would be applicable to MTPC3. For dynamic trafficking studies, researchers can use inducible expression systems and live-cell imaging to track protein movement in response to metal stress or other stimuli.

How can researchers effectively generate and characterize MTPC3 mutants?

Several approaches can be used to generate and characterize MTPC3 mutants:

  • T-DNA insertion lines: Identifying existing T-DNA insertions in MTPC3 from collections like SALK, GABI-Kat, or SAIL

  • CRISPR-Cas9 gene editing: For precise modification of specific MTPC3 residues

  • RNAi silencing: To achieve knockdown of MTPC3 expression

  • Overexpression lines: To study gain-of-function effects

For functional characterization, researchers should employ:

  • Metal tolerance assays: Measuring root growth on media containing different concentrations of metals

  • Metal content analysis: Using ICP-MS or ICP-OES to quantify metal accumulation in different tissues

  • Heterologous expression: Testing MTPC3 function in metal-sensitive yeast mutants (e.g., zrc1 cot1)

For AtMTP3, researchers have used RNA interference to silence gene expression, resulting in zinc hypersensitivity and enhanced zinc accumulation in above-ground organs under excess zinc or iron deficiency conditions .

What high-throughput screening methods are suitable for identifying factors interacting with MTPC3?

Several screening methods can identify MTPC3-interacting partners and regulatory factors:

  • Yeast two-hybrid (Y2H) screening: To identify protein-protein interactions

  • Split-ubiquitin membrane Y2H: More suitable for membrane proteins like MTPC3

  • Co-immunoprecipitation coupled with mass spectrometry: To identify protein complexes in planta

  • Genetic suppressor screens: To identify genetic interactors

  • Machine learning-based differential network analysis: To identify co-expressed genes and potential regulators

Machine learning approaches have been successfully applied to identify stress-responsive genes in Arabidopsis . A similar approach could be adapted to identify genes co-regulated with MTPC3 under various metal stress conditions, providing insights into its functional network.

How does MTPC3 contribute to metal ion homeostasis in Arabidopsis?

Based on studies of related MTPs, particularly AtMTP3, MTPC3 likely plays a critical role in zinc homeostasis by:

  • Sequestering excess zinc in the vacuole

  • Preventing toxic accumulation of zinc in the cytoplasm

  • Controlling zinc partitioning between roots and shoots

AtMTP3 has been shown to mediate zinc exclusion from shoots under iron deficiency and zinc oversupply . Silencing of AtMTP3 by RNA interference causes zinc hypersensitivity and enhanced zinc accumulation in above-ground organs, while overexpression increases zinc accumulation in both roots and rosette leaves and enhances zinc tolerance . This suggests that MTPC3 may function similarly in maintaining proper zinc distribution within the plant, particularly under conditions that promote high zinc uptake.

What is the relationship between MTPC3 function and iron deficiency responses?

Iron deficiency strongly induces AtMTP3 expression in Arabidopsis, particularly in epidermal and cortex cells of the root hair zone . This induction is likely a protective mechanism because:

  • Iron deficiency upregulates the general metal uptake machinery

  • This can lead to increased uptake of other metals, including zinc

  • Excess zinc can interfere with iron acquisition and utilization

By sequestering excess zinc in the vacuole and preventing its translocation to shoots, MTPC3 likely helps maintain proper metal balance during iron deficiency. This represents a critical adaptive response that prevents zinc toxicity while the plant attempts to increase iron acquisition. Silencing of AtMTP3 enhances zinc accumulation in shoots under iron deficiency, supporting this protective role .

How do point mutations affect MTPC3 transport activity and metal specificity?

While specific information about MTPC3 point mutations is not provided in the search results, insights can be drawn from studies of related proteins. For example:

  • Conserved transmembrane domains typically contain residues essential for metal binding and transport

  • Point mutations in these regions can alter metal specificity, transport rate, or abolish activity entirely

  • Regulatory domains may contain residues involved in sensing metal status or protein-protein interactions

The specific effects of point mutations would depend on the affected residue's role in MTPC3 function. Structure-function studies of related transporters, such as those done with TTN5 where point mutants (T30N and Q70L) were created to study nucleotide exchange and GTP hydrolysis , provide models for similar approaches with MTPC3. Functional complementation in yeast metal-sensitive mutants provides a straightforward system for testing the effects of specific mutations on transport activity.

How can MTPC3 be utilized for phytoremediation applications?

MTPC3's role in metal sequestration makes it a potential target for phytoremediation engineering:

  • Overexpression of MTPC3 could enhance plant tolerance to toxic metals

  • Modifying MTPC3 expression patterns could alter metal partitioning between roots and shoots

  • Engineering MTPC3 variants with altered metal specificity could target specific contaminants

What approaches are most effective for studying MTPC3 natural variation in Arabidopsis ecotypes?

Studying natural variation in MTPC3 across Arabidopsis ecotypes can provide insights into adaptive mechanisms for different metal environments:

  • Sequence analysis of MTPC3 alleles from diverse ecotypes

  • Expression analysis across ecotypes from different environments

  • QTL mapping using recombinant inbred line (RIL) populations

  • Advanced intercross recombinant inbred lines (AI-RILs) for high-resolution mapping

AI-RILs provide an excellent resource for high-precision QTL mapping with expanded genetic maps containing more recombination events than traditional RIL populations . For example, AI-RIL populations derived from crosses of Columbia (Col) to Estland (Est-1) and Kendallville (Kend-L) have been genotyped with over 100 common markers, making them excellent material for comparative QTL mapping . Similar approaches could be applied to identify natural variants of MTPC3 with altered function or regulation.

How can interacting QTLs affecting MTPC3 function be effectively mapped and characterized?

Mapping interacting QTLs that affect MTPC3 function requires specialized approaches:

  • Advanced intercross populations (AI-RILs) to increase mapping resolution

  • Multi-environment phenotyping to identify context-dependent QTLs

  • Statistical models that explicitly test for epistatic interactions

  • Near-isogenic lines (NILs) to confirm QTL effects

AI-RIL populations in Arabidopsis have demonstrated the power of this approach, with genetic maps expanded through additional recombination events, allowing detection of closely linked QTLs that might otherwise appear as a single locus . When studying metal tolerance traits, phenotyping should be performed under various metal stress conditions to identify environment-specific QTLs and interactions. Comparative QTL mapping across different RIL populations can further enhance the identification of robust loci affecting MTPC3 function.

What are common challenges when expressing recombinant MTPC3 and how can they be addressed?

Membrane proteins like MTPC3 present several challenges for recombinant expression:

  • Protein misfolding and aggregation

  • Low expression levels

  • Toxicity to expression hosts

  • Difficulties in solubilization and purification

These challenges can be addressed through:

  • Using specialized expression systems designed for membrane proteins

  • Optimizing growth conditions (temperature, induction timing, media composition)

  • Creating fusion constructs with solubility-enhancing tags

  • Testing multiple detergents for optimal solubilization

  • Considering cell-free expression systems for toxic proteins

For functional studies, heterologous expression in yeast mutants lacking endogenous metal transporters (e.g., zrc1 cot1) can provide a clean system for assessing transport activity . For structural studies, expression optimization might require testing multiple constructs with different boundaries and fusion partners.

How can researchers address data inconsistencies in MTPC3 metal specificity studies?

Inconsistencies in metal specificity data can arise from several sources:

  • Different experimental systems (in vitro vs. in vivo)

  • Variable expression levels affecting apparent specificity

  • Different metal concentrations used in assays

  • Presence of contaminating metals in supposedly pure metal solutions

  • Interactions with endogenous transporters in heterologous systems

To address these issues:

  • Use multiple complementary approaches to assess metal specificity

  • Carefully control metal concentrations and purity

  • Include appropriate positive and negative controls

  • Perform dose-response curves rather than single-concentration tests

  • Consider competitive transport assays with multiple metals

  • Use multiple heterologous systems to confirm findings

Metal content analysis using ICP-MS or ICP-OES should be performed on both plant tissues and growth media to accurately quantify metal uptake and distribution.

What controls are essential when evaluating MTPC3 phenotypes in mutant lines?

Proper controls are critical for rigorous evaluation of MTPC3 mutant phenotypes:

  • Multiple independent transgenic/mutant lines to rule out positional effects

  • Complementation with the wild-type gene to confirm phenotype causality

  • Controls for expression level effects (using expression measurement)

  • Appropriate wild-type controls matched to the genetic background

  • Environmental controls (light, temperature, humidity)

  • Media composition controls, particularly metal concentrations

When silencing AtMTP3 by RNA interference, researchers observed zinc hypersensitivity and enhanced zinc accumulation in above-ground organs . Such findings should be verified across multiple independent transgenic lines and complemented with the wild-type gene to confirm specificity. Additionally, gene expression should be quantified to correlate phenotype strength with silencing efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.