Recombinant Arabidopsis thaliana Putative pectinesterase 11 (PME11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Putative Pectinesterase 11 (PME11)

Arabidopsis thaliana Putative Pectinesterase 11 (PME11) is an enzyme that belongs to the pectin methylesterase (PME) family . PMEs (EC 3.1.1.11) are responsible for the demethylesterification of pectin in plant cell walls . In Arabidopsis thaliana, the PME protein family is extensive, comprising 66 members .

Recombinant Arabidopsis thaliana Putative Pectinesterase 11 (PME11) is the product of the PME11 gene, also known as ARATH11, with ordered locus name At2g21610 and ORF name F2G1.12 . It is a full-length protein consisting of 352 amino acids .

Biochemical Characteristics

The recombinant protein is available in a Tris-based buffer with 50% glycerol for stability . It is recommended to store it at -20°C for extended storage and to avoid repeated freezing and thawing . Working aliquots can be stored at 4°C for up to one week .

Expression and Function of PMEs

PME11 is a member of a large gene family in Arabidopsis thaliana . Comprehensive expression profiling has revealed diverse expression patterns among PMEs, suggesting specialized roles in plant development and physiology . Some PMEs are highly expressed in floral buds, while others are specific to silique developmental stages or ubiquitously expressed . PMEs play a role in pectin remodeling and cell wall disassembly during various physiological processes, including plant-microbe interactions and stress responses .

Role in Plant Immunity

Plant PMEs play a critical role in plant-microbe interactions and stress responses . Pathogen-induced PME (PI-PME) activity is triggered in Arabidopsis thaliana when infected with microbial pathogens . This activity could favor the release of de-methylesterified oligogalacturonides, which can trigger plant immunity .

PME Inhibitors

Pectin Methylesterase Inhibitors (PMEIs) regulate PME activity . For example, Arabidopsis thaliana PECTIN METHYLESTERASE INHIBITOR 3 (PMEI3) is used to manipulate PME activity in vivo . PMEI3 inhibits PME activity in acidic pH conditions but does not affect it at neutral pH .

AtPME17 as a Functional PME

Arabidopsis thaliana PME17 (AtPME17) contributes to PI-PME activity and resistance against B. cinerea . Mutants defective in AtPME17 show a defective induction of PI-PME activity and increased susceptibility to B. cinerea .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your own protocols.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PME11; ARATH11; At2g21610; F2G1.12; Putative pectinesterase 11; PE 11; Pectin methylesterase 11; AtPME11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PME11
Target Protein Sequence
MGLYKTKSKRSIANYHHIIIINIFILSSITSSSMASSSSPSSIDFSTAILIRVDQSGKGD FSKIQEAIESIPPNLNNSQLYFIWVKPGIYREKVVIPAEKPYITLSGTQASNTFLIWSDG EDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRVAADKAAFYGCVITSYQDTLLDD NGNHYFKNCYIEGATDFICGSASSLYERCHLHSLSPNNGSITAQMRTSATEKSGFTFLGC KLTGSGSTFLGRPWGAYSRVVFAYSFFSNVVAPQGWNQWGDSTKENTVYYGEYKCYGPGA DREQRVEWSKQLSDEEATVFLSKDFIGGKDWLRPAPSHFKNAPKQTQNKEIN
Uniprot No.

Target Background

Function
Involved in cell wall modification through the demethylesterification of pectin.
Database Links
Protein Families
Pectinesterase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PME11 and how does it fit within the Arabidopsis PME family?

PME11 belongs to the large 66-member PME gene family in Arabidopsis thaliana. These enzymes catalyze the demethylesterification of homogalacturonans in plant cell walls, generating negatively charged carboxyl groups that can crosslink with calcium ions to alter cell wall properties . The PME family in Arabidopsis shows diverse expression patterns throughout development, with members clustered into distinct expression groups related to specific developmental processes . PME11 is part of this complex family that regulates cell wall integrity, cell expansion, and responses to environmental stimuli.

What expression patterns characterize PME11 in Arabidopsis tissues?

While specific expression data for PME11 is not detailed in the provided sources, PME family members in Arabidopsis show distinct expression patterns that can be clustered into five groups: (1) those highly/uniquely expressed in floral buds (19 members), (2) those uniquely expressed at mid-silique developmental stages (4 members), (3) those highly/uniquely expressed in siliques at late developmental stages (16 members), (4) those mostly ubiquitously expressed (16 members), and (5) those with specific expression patterns . Understanding PME11's expression profile would require real-time RT-PCR analysis across developmental stages, as was done for the broader family characterization.

What techniques can be used to measure PME11 activity in plant tissues?

PME activity can be quantitatively measured using commercially available kits, such as the Pectinesterase (PE) kit from biotechnology companies . The methodology typically involves:

  • Harvesting plant tissue (roots, stems, leaves) at appropriate developmental stages

  • Sample homogenization in extraction buffer

  • Centrifugation to obtain clear extracts

  • Incubation with pectin substrate under controlled conditions

  • Spectrophotometric measurement of reaction products

For Arabidopsis, protocols have been established to measure PME activity in 35-day-old plants grown under controlled conditions (16h/8h light/dark cycles at 22°C) . Each measurement should include at least three biological replicates for statistical validity.

What are the most effective protocols for recombinant expression and purification of Arabidopsis PME11?

Based on successful protocols for related proteins like PMEI3, a recommended expression system for PME11 would be Pichia pastoris with the pPICZαB vector . This methodology includes:

  • Gene preparation:

    • Design a plant codon-optimized PME11 sequence

    • Clone into pPICZαB vector with α-factor secretion signal

    • Verify in-frame fusion by sequencing

  • Transformation and expression:

    • Transform linearized plasmid into Pichia pastoris strain X33

    • Select transformants on YPDS medium with 50 μg/mL Zeocin

    • Culture in BMGY medium followed by transfer to BMMY for induction

    • Maintain methanol concentration at 0.5% (v/v) during expression

  • Purification:

    • Collect and concentrate culture supernatant

    • Purify using appropriate chromatography methods

    • Confirm protein identity using mass spectrometry

    • Analyze protein purity by SDS-PAGE

This methodology has proven effective for PMEI proteins and could be adapted for PME11 with optimization of expression conditions.

How do PME inhibitors (PMEIs) affect PME11 activity and what methods can be used to study these interactions?

PMEIs are endogenous regulators of PME activity in plants. To study PMEI interactions with PME11:

  • In vitro inhibition assays:

    • Express and purify recombinant PME11 and PMEIs

    • Conduct enzyme activity assays with varying PMEI concentrations

    • Determine inhibition kinetics (Ki values)

    • Test pH-dependence of inhibition (PMEIs typically inhibit PMEs at acidic pH but not at neutral pH)

  • Specificity analysis:

    • Compare inhibition profiles against different PMEs

    • As observed with PMEI3, specific inhibitors may show different affinities for various PME family members

  • Structural studies:

    • Perform co-crystallization of PME11-PMEI complexes

    • Use molecular docking to predict interaction interfaces

These approaches would help determine if PME11 is regulated by specific PMEIs and under what conditions this regulation occurs.

What role does PME11 play in plant responses to abiotic stresses?

While specific information on PME11's role in stress responses is not provided in the search results, research on related PME/PMEI proteins suggests potential functions in abiotic stress tolerance:

  • Heavy metal stress response:

    • PMEIs like MePMEI1 enhance lead (Pb) tolerance when overexpressed in Arabidopsis

    • This is achieved through:
      a) Reduced PME activity leading to higher cell wall methylesterification
      b) Thickening of cell walls that may restrict heavy metal entry
      c) Enhanced antioxidant enzyme activities (CAT, SOD)
      d) Reduced oxidative damage (lower MDA and H₂O₂ levels)

  • Experimental approaches to study PME11 in stress responses:

    • Generate transgenic Arabidopsis lines overexpressing or silencing PME11

    • Expose plants to various stresses (heavy metals, drought, salinity)

    • Measure physiological parameters, PME activity, cell wall properties, and stress markers

    • Compare phenotypes between transgenic and wild-type plants

ParameterWild-typePME11-overexpressionPME11-silencing
PME activityBaselineIncreasedDecreased
Cell wall methylesterificationModerateDecreasedIncreased
Stress toleranceBaselineTo be determinedTo be determined
Oxidative markersBaselineTo be determinedTo be determined

This experimental design would help elucidate PME11's specific contributions to stress responses.

What cellular techniques are effective for studying PME11 subcellular localization and trafficking?

Effective approaches for studying PME11 localization include:

  • Fluorescent protein fusions:

    • Generate PME11-GFP/RFP fusion constructs

    • Express in Arabidopsis under native or constitutive promoters

    • Visualize using confocal microscopy

    • Co-localize with known cell compartment markers

  • Immunolocalization:

    • Develop specific antibodies against PME11

    • Perform immunogold labeling for transmission electron microscopy

    • Conduct immunofluorescence for confocal microscopy

  • Cell fractionation:

    • Isolate cell wall, plasma membrane, and other cellular fractions

    • Detect PME11 in fractions using Western blotting

    • Measure PME activity in different cellular compartments

These approaches would help determine if PME11 is primarily localized to the cell wall, as observed with other PME family members and PMEIs like MePMEI1 .

How can researchers accurately assess the effects of PME11 on cell wall architecture?

Cell wall modifications by PME11 can be assessed through multiple complementary techniques:

  • Biochemical characterization:

    • Measure the degree of methylesterification (DM) of cell wall pectins

    • Quantify calcium cross-linking between demethylesterified galacturonic acid residues

    • Analyze cell wall composition (pectin, cellulose, hemicellulose ratios)

  • Microscopic analysis:

    • Perform immunolabeling with antibodies specific for different pectin methylesterification states (JIM5, JIM7)

    • Measure cell wall thickness using transmission electron microscopy

    • Analyze cell wall ultrastructure

  • Mechanical testing:

    • Determine cell wall extensibility using creep tests

    • Measure tissue mechanical properties using atomic force microscopy

    • Assess cellular stiffness through micro-indentation

  • Growth phenotyping:

    • Measure growth parameters in PME11-modified plants

    • Analyze root elongation rates under different conditions

    • Document cell expansion patterns during organ development

These approaches would provide comprehensive understanding of how PME11 activity influences cell wall architecture and mechanical properties.

What are the critical considerations when designing primers for PME11 cloning and expression?

When designing primers for PME11 cloning:

  • Sequence verification:

    • Confirm the correct gene annotation in Arabidopsis genome databases

    • Check for potential splice variants that might affect protein function

  • Expression vector compatibility:

    • Include appropriate restriction sites for the target vector

    • Ensure in-frame fusion with tags (His, GST) or signal peptides

    • Consider codon optimization for the expression host (e.g., Pichia pastoris)

  • Domain structure:

    • Determine if cloning full-length PME11 including pro-domain is necessary

    • Consider separate cloning of catalytic domain for activity studies

    • Note that some PMEs lack PRO domains, which may affect their function

  • PCR optimization:

    • Design primers with appropriate melting temperatures

    • Account for GC content and secondary structures

    • Include buffer sequences at 5' ends for efficient restriction enzyme digestion

Proper primer design ensures successful cloning and expression of functional recombinant PME11 protein.

How can researchers effectively measure PME11 enzymatic kinetics?

To characterize PME11 enzymatic kinetics:

  • Substrate preparation:

    • Use commercially available pectin with defined degree of methylesterification

    • Prepare pectin solutions at different concentrations for Km determination

  • Reaction conditions optimization:

    • Test activity across pH range (typically 4.0-7.5)

    • Determine temperature optimum (typically 25-37°C)

    • Assess requirements for cofactors (Ca²⁺, other ions)

  • Kinetic measurements:

    • Monitor reaction progress in real-time using:
      a) pH-stat method (tracking proton release)
      b) Colorimetric detection of methanol release
      c) Ruthenium red binding to demethylesterified pectin

    • Calculate kinetic parameters (Km, Vmax, kcat)

  • Inhibition studies:

    • Test effects of known PMEIs at different concentrations

    • Determine inhibition constants and mechanisms

    • Note that inhibition is typically pH-dependent, with stronger inhibition at acidic pH

These approaches provide comprehensive characterization of PME11 catalytic properties.

What transgenic approaches are most effective for studying PME11 function in planta?

Effective transgenic approaches include:

  • Overexpression studies:

    • Clone PME11 under constitutive (35S) or tissue-specific promoters

    • Transform Arabidopsis using floral dip method

    • Select stable transformants and confirm expression levels

    • Analyze T3 homozygous lines for consistent phenotypes

  • Gene silencing/knockout:

    • Generate PME11 knockouts using T-DNA insertion lines

    • Design CRISPR/Cas9 constructs targeting PME11

    • Create RNAi constructs for conditional silencing

    • Verify reduction of transcript/protein levels

  • Promoter studies:

    • Clone PME11 promoter region upstream of reporter genes (GUS, GFP)

    • Analyze spatiotemporal expression patterns

    • Identify regulatory elements controlling expression

  • Complementation experiments:

    • Introduce native or modified PME11 into knockout backgrounds

    • Test functional domains through targeted mutations

    • Assess rescue of mutant phenotypes

  • Phenotypic analysis:

    • Examine growth parameters (root length, leaf size, etc.)

    • Assess stress responses

    • Analyze cell wall properties

    • Measure PME activity in transgenic lines

These approaches have been successfully applied to study PMEI proteins and can be adapted for PME11 functional characterization.

How should researchers interpret contradictory findings regarding PME11 function?

When faced with contradictory findings:

  • Experimental context analysis:

    • Compare growth conditions (light, temperature, soil composition)

    • Evaluate plant developmental stages examined

    • Consider tissue-specificity of effects

    • Assess genetic background of plants used

  • Methodological differences:

    • Analyze protein expression/purification protocols

    • Compare activity assay conditions (pH, temperature, substrate)

    • Evaluate specificity of detection methods

    • Consider temporal aspects of experiments

  • Redundancy considerations:

    • Assess potential compensatory effects from other PME family members

    • Analyze expression changes in related genes

    • Consider generating multiple-gene knockouts

  • Statistical validation:

    • Ensure sufficient biological and technical replicates

    • Apply appropriate statistical tests

    • Consider effect sizes, not just p-values

  • Integrative approach:

    • Combine biochemical, genetic, and phenotypic data

    • Use multiple experimental techniques to validate findings

    • Consider systems biology approaches to understand network effects

Understanding contradictions often leads to deeper insights into complex biological functions.

What bioinformatic tools are most useful for analyzing PME11 in the context of the broader PME family?

Valuable bioinformatic approaches include:

  • Sequence analysis:

    • Multiple sequence alignment of Arabidopsis PME family members

    • Identification of conserved catalytic residues and domains

    • Classification based on presence/absence of PRO domain

  • Phylogenetic analysis:

    • Construction of phylogenetic trees to determine evolutionary relationships

    • Correlation of phylogenetic groupings with expression patterns

    • Identification of orthologous PMEs in other plant species

  • Expression data mining:

    • Analysis of transcriptomic datasets across tissues and conditions

    • Clustering of co-expressed genes

    • Identification of regulatory networks

  • Protein structure prediction:

    • Homology modeling based on crystallized PME structures

    • Molecular docking simulations with substrates and inhibitors

    • Prediction of interaction interfaces with PMEIs

  • Promoter analysis:

    • Identification of regulatory elements in PME11 promoter

    • Comparison with promoters of co-expressed PME genes

    • Prediction of transcription factor binding sites

These approaches provide a comprehensive understanding of PME11 in the context of the entire PME family.

What emerging technologies could advance our understanding of PME11 function?

Cutting-edge approaches with potential include:

  • Advanced imaging technologies:

    • Super-resolution microscopy for cell wall structural analysis

    • FRET-based sensors for real-time PME activity visualization

    • 3D electron tomography of cell wall architecture

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-specific PME11 expression

    • Single-cell proteomics to quantify PME11 protein levels

    • Spatial transcriptomics to map expression patterns with subcellular resolution

  • CRISPR technologies:

    • Base editing for introducing specific PME11 mutations

    • CRISPRi for temporal control of PME11 expression

    • CRISPR screens to identify genetic interactors

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis of cell wall modification pathways

    • Mathematical modeling of pectin methylesterification dynamics

These emerging technologies promise to provide unprecedented insights into PME11 function and regulation.

How might PME11 function in uncharacterized physiological processes?

Potential unexplored functions include:

  • Biotic stress responses:

    • Role in pathogen recognition and defense signaling

    • Contribution to cell wall reinforcement during infection

    • Potential priming effects for systemic acquired resistance

  • Developmental transitions:

    • Function in seed germination and dormancy

    • Role in senescence and programmed cell death

    • Contribution to abscission zone formation

  • Environmental adaptation:

    • Involvement in thermotolerance mechanisms

    • Function in low-oxygen response during flooding

    • Role in gravitropic and thigmotropic responses

  • Cellular signaling:

    • Generation of oligogalacturonide signaling molecules

    • Modulation of calcium signaling through altered pectin-calcium binding

    • Potential roles beyond the cell wall in unexplored cellular compartments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.