Recombinant Arabidopsis thaliana Putative pectinesterase/pectinesterase inhibitor 28 (PME28)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Putative Pectinesterase/Pectinesterase Inhibitor 28 (PME28)

Arabidopsis thaliana Putative Pectinesterase/Pectinesterase Inhibitor 28 (PME28) is a protein found in the model plant Arabidopsis thaliana, also known as mouse-ear cress . PME28 is classified as a pectinesterase inhibitor that may regulate pectin methylesterase (PME) activity, which is important for plant development by influencing the mechanical characteristics of the plant cell wall .

Gene and Protein Information

The gene name for PME28 is PME28, with synonyms including ARATH28 and ordered locus name At5g27870 . The protein is also known as pectin methylesterase inhibitor 28 or pectinesterase 28 . The full-length protein consists of 732 amino acids . PME28 contains a PMEI (pectin methylesterase inhibitor) region, which may serve as an autoinhibitory domain to prevent premature PME activity during transport .

Expression and Localization

Quantitative RT-PCR analysis has shown that AtPMEI1 and 2 mRNA expression is tightly regulated during plant development, with the highest mRNA levels found in flowers . Further studies using promoter::GUS fusions revealed that expression is mainly limited to pollen .

Function and Catalytic Activity

PME28 is a proteinaceous inhibitor of PME in Arabidopsis thaliana . Recombinant AtPMEI1 and 2 proteins can inhibit PME activity from flowers and siliques . PMEs play a crucial role in plant development by affecting the mechanical properties of the plant cell wall .

Role in Aluminum and Proton Tolerance

Arabidopsis thaliana is also used in genome-wide association studies (GWAS) to understand complex mechanisms, especially when integrated with other data . For example, the relative root length of seedlings grown in aluminum (Al) and proton solutions correlates with the tolerance of Arabidopsis to Al and proton rhizotoxicities in acid soils . Genes related to Al tolerance, such as RGFR2, AtTRX1, and AtTRM28, have been identified through these studies, suggesting that PME28 may also play a role in stress responses .

Recombinant PME28

Recombinant PME28 is available for purchase in various sizes and can be produced in different expression systems such as Yeast, E. coli, Baculovirus, and Mammalian cells . It is typically stored in a Tris-based buffer with 50% glycerol and should be stored at -20℃ or -80℃ for extended storage . Repeated freezing and thawing are not recommended .

Impact on Human Health

Arabidopsis thaliana is a key model system in biology and has significantly impacted human health research . Studies using Arabidopsis have helped identify prototype proteins and domains involved in human diseases, human development, and other important aspects of human biology .

Disease Resistance

Genome-wide association studies using Arabidopsis thaliana have identified genes involved in the infection response to pathogens like the turnip mosaic virus (TuMV) . These studies provide insights into the genetic basis of plant resistance to viruses and can help identify potential host targets for virus adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PME28; ARATH28; At5g27870; F14I23.30; Putative pectinesterase/pectinesterase inhibitor 28 [Includes: Pectinesterase inhibitor 28; Pectin methylesterase inhibitor 28; Pectinesterase 28; PE 28; Pectin methylesterase 28; AtPME28]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-732
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PME28
Target Protein Sequence
MSYGYDDEDAKRKKRYVIISISSVLLISMVVAVTIGVSVNKSDNAGDEEITTSVKAIKDV CAPTDYKETCEDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRAKM ALDQCKELMDYAIGELSKSFEELGKFEFHKVDEALVKLRIWLSATISHEQTCLDGFQGTQ GNAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFPSWMDARARR LLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKEYVQVNRSM THLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIAFENTAGAIKHQAVA IRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRK PLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIM NTFIPDFVPPEGWQPWLGEFGLNTLFYSEVQNTGPGAAITKRVTWPGIKKLSDEEILKFT PAQYIQGDAWIPGKGVPYILGLFSGNGSTNSTVTGSSLSSNTTESSDSPSTVVTPSTSPP AGHLGSPSDTPSSVVSPSTSLPAGQLGAPPATPSMVVSPSTSPPAGHLGSPSDTPSSLVS PSTSPPAGHLGSPSDTPSSVVTPSASPSTSPSASPSVSPSAFPSASPSASPSASPSVSPS ASPSASPQSSIG
Uniprot No.

Target Background

Function

Function: Involved in cell wall modification through the demethylesterification of cell wall pectin.

Database Links
Protein Families
PMEI family; Pectinesterase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in flower buds.

Q&A

What is the functional role of PME28 in Arabidopsis thaliana?

PME28 is one of the 66 pectin methylesterase genes in Arabidopsis that controls the esterification status of pectin in plant cell walls. Like other PMEs, it likely deesterifies pectins (which are synthesized in a heavily methylesterified form in the Golgi) upon export to the cell wall . PMEs have been linked to plant immunity responses, with single, double, triple, and quadruple PME mutants showing increased susceptibility to pathogens such as Pseudomonas syringae pv maculicola ES4326 (Pma ES4326) . The specific contribution of PME28 to plant immunity would involve its precise pattern of pectin modification rather than simply its contribution to total PME activity.

How is PME28 expression regulated during pathogen attack?

PME activity increases during pattern-triggered immunity and after inoculation with pathogens such as Alternaria brassicicola or Pma ES4326 . This pathogen-induced increase in PME activity coincides with a decrease in pectin methylesterification . Regulation of PME activity, including potentially that of PME28, is dependent on jasmonic acid (JA) signaling pathways . The ethylene response factor branch of JA signaling contributes to PME induction by A. brassicicola, while both this branch and the MYC2 branch contribute to induction by Pma ES4326 . Monitoring PME28 expression specifically would require gene-specific primers for qRT-PCR or antibodies for protein detection to differentiate it from other PME family members.

What post-translational modifications affect PME28 activity?

While the search results don't provide specific information about PME28 post-translational modifications, PMEs in general undergo important modifications that affect their activity. In an Arabidopsis-based expression system, proteins undergo proper post-translational modifications and associate with their native partners to form active complexes . For PME28 research, consider examining N-glycosylation patterns, as multiple N-glycans have been shown to cooperate in the subcellular targeting and functioning of some Arabidopsis proteins . Methods to study these modifications include mass spectrometry analysis of purified PME28 and comparison between wild-type and glycosylation pathway mutants.

What expression systems are optimal for producing recombinant PME28?

An Arabidopsis-based super-expression system represents an excellent platform for producing recombinant PME28, with yields of up to 0.4 mg of purified protein per gram fresh weight demonstrated for other proteins . This homologous expression system ensures proper post-translational modifications and complex formation with endogenous interaction partners, which may be crucial for PME28 function . The methodology involves:

  • Cloning the PME28 cDNA into an appropriate plant expression vector

  • Transforming Arabidopsis using the floral dip method, which is described as "very easy and widely used in standard laboratory set-ups"

  • Screening individual transformants for high expression levels

  • Establishing cell lines from high expressors that can be maintained in petri dish-based culture systems at ambient temperature (25°C) in darkness

  • Harvesting biomass (typically 20-30g) for laboratory-scale experiments after approximately one week of growth

Using the rdr6-11 mutant background as the standard host is recommended to avoid gene silencing (similar to P19 co-expression in Nicotiana benthamiana systems) .

What are the most effective methods for measuring PME28 enzymatic activity?

PME activity can be effectively measured using a gel diffusion assay after extracting cytoplasmic and cell wall-bound proteins from homogenized plant samples . This method allows researchers to detect changes in PME activity over time following pathogen infection or treatment with molecular patterns like flg22 or elf18 . For PME28-specific activity measurements:

  • Generate PME28 overexpression lines and corresponding knockout mutants

  • Extract proteins using appropriate buffers that maintain enzyme activity

  • Perform the gel diffusion assay using ruthenium red staining to visualize pectin demethylesterification

  • Compare activity between genotypes and treatments

  • Complement with in vitro activity assays using purified recombinant PME28 and methylesterified pectin substrates

For detailed analysis, combine these biochemical approaches with immunological detection using PME28-specific antibodies and enzyme kinetic studies.

How can researchers create and validate PME28 mutant lines?

Creating and validating PME28 mutant lines is essential for functional characterization. Based on approaches used for other PME genes, researchers should:

  • Obtain T-DNA insertion lines from repositories like the Arabidopsis Biological Resource Center

  • Confirm homozygosity through genotyping PCR using gene-specific and T-DNA border primers

  • Verify the absence of PME28 transcript using RT-PCR and qRT-PCR

  • Complement mutant lines with the wild-type PME28 gene to confirm phenotypes are due to the mutation

  • Create higher-order mutants by crossing with other PME mutants to address genetic redundancy

  • Consider CRISPR/Cas9 approaches for targeted mutagenesis when T-DNA lines are unavailable

Validation should include assessing total PME activity, which might not show measurable decreases in single mutants due to redundancy with other PME family members .

How should researchers interpret changes in pectin methylesterification patterns in PME28 mutants?

Interpreting changes in pectin methylesterification patterns requires sophisticated analytical approaches since the determinant of immunity is not total PME activity but rather specific effects of PMEs such as changes in the pattern of pectin methylesterification . Researchers should:

  • Extract cell wall material from wild-type and PME28 mutant plants

  • Analyze the degree of methylesterification using FT-IR spectroscopy or immunolabeling with antibodies that recognize specific methylesterification patterns

  • Compare patterns before and after pathogen challenge

  • Correlate changes in methylesterification with susceptibility/resistance phenotypes

  • Distinguish PME28-specific effects from those of other PMEs by comparing with other single and higher-order PME mutants

Remember that the specific pattern of demethylesterification may be more relevant for immunity than total PME activity , so detailed analysis of methylesterification patterns is essential.

What approaches help distinguish between the roles of PME28 and other PMEs in plant immunity?

Due to the extensive genetic redundancy among the 66 PME genes in Arabidopsis , distinguishing PME28's specific role requires multiple complementary approaches:

  • Generate and phenotype single, double, triple, and quadruple mutants involving PME28 and related PMEs

  • Create PME28-specific overexpression lines using both constitutive and inducible promoters

  • Perform detailed spatiotemporal expression analysis using PME28 promoter-reporter constructs

  • Conduct complementation experiments with PME28 and closely related PMEs

  • Analyze substrate specificity using recombinant proteins and different pectin substrates

  • Perform protein-protein interaction studies to identify PME28-specific partners

Compare immune responses to different pathogens (necrotrophs like A. brassicicola versus hemibiotrophs like Pma ES4326) in these genetic backgrounds, as different PMEs may play pathogen-specific roles .

How can transcriptomic data be analyzed to understand PME28 regulation in different defense pathways?

Transcriptomic analysis provides valuable insights into PME28 regulation during defense responses. Based on what we know about PME regulation:

  • Design RNA-seq experiments comparing wild-type plants with JA signaling mutants (both ethylene response factor and MYC2 branches) after pathogen challenge

  • Include time course analysis to capture early and late defense responses

  • Apply differential expression analysis to identify co-regulated genes

  • Perform gene ontology enrichment and pathway analysis to place PME28 in specific defense networks

  • Validate key findings with qRT-PCR targeting PME28 and related genes

  • Compare expression patterns after treatment with different molecular patterns (flg22, elf18) and pathogens

Since pathogen-induced PME activity depends on JA signaling but not salicylic acid or ethylene signaling , focus analysis on JA-responsive genes and regulatory elements in the PME28 promoter.

What molecular mechanisms determine PME28 substrate specificity?

Understanding PME28 substrate specificity requires detailed biochemical and structural approaches:

  • Express and purify recombinant PME28 using the Arabidopsis super-expression system

  • Perform enzyme kinetics studies with different pectin substrates varying in degree and pattern of methylesterification

  • Conduct site-directed mutagenesis of potential catalytic residues

  • Obtain structural information through X-ray crystallography or cryo-electron microscopy

  • Compare with structures of other PMEs with known specificities

  • Perform molecular dynamics simulations to understand substrate binding

These approaches would elucidate whether PME28 acts randomly or processively on the pectin backbone, and whether it shows preferences for specific methylesterification patterns.

How does PME28 coordinate with pectinesterase inhibitors (PMEIs) during immune responses?

PME28 is classified as a putative pectinesterase/pectinesterase inhibitor, suggesting a complex regulatory relationship with inhibitory domains or proteins. To investigate this:

  • Examine PME28 protein structure to identify potential inhibitory domains

  • Test for intramolecular regulation through truncation experiments

  • Screen for interacting PMEIs using yeast two-hybrid or co-immunoprecipitation approaches

  • Analyze expression correlation between PME28 and potential inhibitory partners during immune responses

  • Create double mutants lacking both PME28 and specific PMEIs

  • Test effects of purified PMEIs on recombinant PME28 activity in vitro

This research would reveal how plants fine-tune pectin modification during pathogen attack through the interplay of PMEs and their inhibitors.

What role does PME28 play in modulating cell wall integrity sensing during pathogen attack?

The cell wall integrity sensing pathway detects and responds to cell wall damage or alterations. PME28's potential role in this process can be investigated by:

  • Monitoring cell wall integrity markers in PME28 mutants before and after pathogen challenge

  • Analyzing calcium signaling responses, which often mediate cell wall damage perception

  • Investigating whether PME28-modified pectins release specific damage-associated molecular patterns (DAMPs)

  • Testing if PME28 activity affects receptor kinase activation at the plasma membrane

  • Examining if changes in cell wall mechanics due to PME28 activity trigger mechanosensitive channels

  • Creating reporter lines to visualize spatiotemporal activation of defense responses in PME28 mutants

This research would connect PME28's enzymatic function with upstream signaling events that ultimately lead to transcriptional reprogramming during immunity.

How can synthetic biology approaches enhance PME28 functionality for improved plant immunity?

Synthetic biology offers promising approaches to enhance PME28 functionality:

  • Design chimeric PMEs combining the catalytic domain of PME28 with regulatory domains from other PMEs

  • Create synthetic promoters for pathogen-specific PME28 expression

  • Engineer PME28 variants with altered substrate specificity through directed evolution

  • Develop optogenetic tools to control PME28 activity with light

  • Generate self-regulatory circuits linking pathogen perception directly to PME28 activation

These approaches could lead to plants with enhanced immunity against specific pathogens without compromising growth or development.

What is the potential for PME28 in engineering durable disease resistance in crops?

Translating PME28 research to crop improvement requires:

  • Identifying crop orthologs of Arabidopsis PME28 through phylogenetic analysis

  • Characterizing their expression and function during pathogen infection

  • Testing whether overexpression of PME28 or its crop orthologs enhances disease resistance

  • Examining if PME28-mediated resistance is effective against multiple pathogens

  • Evaluating potential growth or yield penalties associated with PME28 modification

  • Developing strategies to restrict PME28 overexpression to infection sites

Consider that for these applications, addressing plant-specific N-glycan modifications might be necessary to optimize enzyme function in different crop species .

How does PME28 activity influence the composition of the plant microbiome?

The plant cell wall forms the interface between plants and their microbiome. PME28's role in this relationship can be explored by:

  • Comparing root and phyllosphere microbiome composition between wild-type and PME28 mutant plants

  • Analyzing if PME28 activity affects colonization by beneficial microbes

  • Testing whether pectin methylesterification patterns influence biofilm formation on plant surfaces

  • Investigating if PME28-modified cell walls release different carbon sources that shape microbial communities

  • Examining whether PME28 activity influences plant-microbe signaling through pectin-derived oligosaccharides

This research would expand our understanding of PME28 beyond pathogen resistance to its broader ecological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.