Recombinant Arabidopsis thaliana Putative pectinesterase/pectinesterase inhibitor 45 (PME45)

Shipped with Ice Packs
In Stock

Description

Introduction

Pectin methylesterase inhibitors (PMEIs) are proteins that regulate the activity of pectin methylesterases (PMEs), which are crucial in plant development by affecting the mechanical properties of the plant cell wall . PMEs control the degree of methylesterification of homogalacturonans (HGs), a main component of pectins in Arabidopsis thaliana . The balance between PME and PMEI activities is vital for cell wall structure and function, influencing processes such as cell elongation, growth, and defense responses .

Function and Role of PMEIs

PMEIs play a significant role in modulating PME activity, impacting plant development and defense mechanisms . In Arabidopsis thaliana, there are 76 PMEI members, highlighting the complexity and potential specificity of PME-PMEI interactions .

Key functions of PMEIs include:

  • Regulation of Cell Wall Properties: By inhibiting PMEs, PMEIs help control the degree of pectin methylesterification, which affects cell wall mechanics and plasticity .

  • Influence on Plant Development: PMEIs are involved in various developmental processes, including cell elongation, root growth, and pollen tube elongation .

  • Defense Against Pathogens: PMEIs can influence the susceptibility of the cell wall to microbial enzymes, providing a defense mechanism against pathogens such as Botrytis cinerea .

  • Response to Abscisic Acid (ABA): PMEIL affects pollen fertility, and ABA treatment of flowering plants can lead to transcriptional interference of PMEIL, resulting in pollen sterility .

PMEI Diversity and Specificity

The large number of PMEIs in Arabidopsis thaliana raises questions about their specificity and functional roles . Different PMEIs exhibit varying biochemical properties and specificities towards PME targets . For example, AtPMEI4 and AtPMEI9, two co-expressed PMEIs, have distinct effects on plant development and show different pH dependencies in their interaction with AtPME3 .

  • AtPMEI4 and AtPMEI9: Molecular dynamics simulations and in vitro experiments have shown that AtPMEI9 is a stronger, less pH-independent inhibitor compared to AtPMEI4 . These differences have biological significance, affecting pollen tube elongation in different microenvironmental conditions .

  • PMEI3: Biochemical characterization of PMEI3 has demonstrated its ability to inhibit PME activity at acidic pH . PMEI3 shows higher activity against PME3 than against PME2, indicating different members of the PMEI family can have specific targets .

Experimental Techniques to Study PMEIs

Various experimental and computational techniques are employed to study PMEIs:

  • Molecular Dynamics (MD) Simulations: MD simulations are used to predict the behavior of PMEIs and identify key residues involved in their interactions with PMEs .

  • In Vitro ** assays:** These assays are used to characterize the activity of PMEIs, including their pH dependence and specificity towards different PME targets .

  • Expression Analysis: Quantitative RT-PCR and promoter::GUS fusions are used to study the expression patterns of PMEI genes during plant development .

  • Plant Growth Assays: Growing Arabidopsis thaliana seedlings in the presence of purified PMEIs can reveal their in vivo effects on root growth and cell expansion .

PMEI4 and PME17 Interaction

PMEI4 is co-expressed with PME17, suggesting it regulates PME17 activity . This interaction sheds light on the interplay of PMEs, PMEIs, and subtilases (SBTs) in fine-tuning pectin structure .

PMEIs and Fungal Infections

Overexpression of PMEIs in Arabidopsis thaliana restricts fungal infection by Botrytis cinerea, suggesting PMEIs play a role in plant defense by influencing the susceptibility of the cell wall to microbial endopolygalacturonases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PME45; ARATH45; At4g33230; F4I10.160; Putative pectinesterase/pectinesterase inhibitor 45 [Includes: Pectinesterase inhibitor 45; Pectin methylesterase inhibitor 45; Pectinesterase 45; PE 45; Pectin methylesterase 45; AtPME45]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PME45
Target Protein Sequence
MAFQDFDKIQERVNAERKRKFRKRIILGVVSVLVVAAAIIGGAFAYVTYENKTQEQGKTT NNKSKDSPTKSESPSPKPPSSAAQTVKAGQVDKIIQTLCNSTLYKPTCQNTLKNETKKDT PQTDPRSLLKSAIVAVNDDLDQVFKRVLSLKTENKDDKDAIAQCKLLVDEAKEELGTSMK RINDSEVNNFAKIVPDLDSWLSAVMSYQETCVDGFEEGKLKTEIRKNFNSSQVLTSNSLA MIKSLDGYLSSVPKVKTRLLLEARSSAKETDHITSWLSNKERRMLKAVDVKALKPNATVA KDGSGNFTTINAALKAMPAKYQGRYTIYIKHGIYDESVIIDKKKPNVTMVGDGSQKTIVT GNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSVFLNCRFE GYQDTLYAYTHRQYYRSCVIIGTVDFIFGDAAAIFQNCDIFIRKGLPGQKNTVTAQGRVD KFQTTGFVIHNCTVAPNEDLKPVKAQFKSYLGRPWKPHSRTVVMESTIEDVIDPVGWLRW QETDFAIDTLSYAEYKNDGPSGATAARVKWPGFRVLNKEEAMKFTVGPFLQGEWIQAIGS PVKLGLYDA
Uniprot No.

Target Background

Function
Involved in cell wall modification through the demethylesterification of cell wall pectin.
Database Links
Protein Families
PMEI family; Pectinesterase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in flower buds and pollen.

Q&A

How does PME45 compare functionally to other characterized PMEIs in Arabidopsis thaliana?

PME45 belongs to the PME/PMEI family in Arabidopsis thaliana, which includes both enzymes with pectin methylesterase activity and inhibitors of these enzymes. While specific functional characterization of PME45 is limited in the literature, related PMEIs such as PMEI3 have been extensively studied. PMEI3 shows pH-dependent inhibition of PME activity, with stronger inhibition under acidic conditions (pH < 7.0) and negligible activity at neutral pH.

PME45 likely possesses a dual domain structure similar to PMEI3, containing both a pectin methylesterase domain and a potential inhibitory domain. This suggests PME45 may self-regulate its enzymatic activity depending on cellular conditions, which distinguishes it from single-domain PMEIs like PMEI3 .

Unlike some characterized PMEIs, PME45 contains the full putative enzyme domain, suggesting it may have evolved different regulatory mechanisms compared to dedicated inhibitors within the same family .

What are the optimal expression and purification methods for recombinant PME45?

The most effective expression system for functional recombinant PME45 is bacterial expression in E. coli with an N-terminal His-tag for purification purposes. The expression and purification protocol involves:

  • Expression vector construction: Cloning the full-length PME45 coding sequence (1-609aa) into a bacterial expression vector with an N-terminal His-tag.

  • Transformation and culture: Transform into an appropriate E. coli strain (e.g., BL21(DE3)), culture in LB medium with appropriate antibiotic selection, and induce expression with IPTG when culture reaches mid-log phase.

  • Cell lysis: Harvest and lyse cells using mechanical disruption or sonication in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and protease inhibitors.

  • Purification: Purify using Ni-NTA affinity chromatography with an imidazole gradient for elution.

  • Quality control: Verify purity by SDS-PAGE (>90% purity is typically achieved) .

This method yields functional protein that can be used for enzymatic assays and inhibition studies. For studying physiological impacts, some researchers have successfully used the Pichia pastoris expression system for related PMEIs, which may provide better post-translational modifications for plant proteins .

What are the recommended storage conditions for maintaining PME45 activity?

To maintain optimal activity of recombinant PME45, follow these evidence-based storage recommendations:

  • Short-term storage (up to one week): Store working aliquots at 4°C in Tris/PBS-based buffer, pH 8.0, supplemented with 6% trehalose.

  • Long-term storage: Store at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles, which significantly reduce activity.

  • Lyophilization: For maximum stability, the protein can be stored as a lyophilized powder.

  • Reconstitution protocol: Prior to use, briefly centrifuge the vial to collect contents at the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal stability, add glycerol to a final concentration of 50% .

These conditions have been empirically determined to maintain >90% of enzymatic activity after storage. Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity through denaturation and aggregation.

What methods can be used to assess PME45 activity in vitro?

Several complementary methods can be employed to measure PME45 activity:

  • Ruthenium red assay: This colorimetric method detects de-methylesterified pectin through binding with ruthenium red dye. The protocol involves:

    • Incubating purified PME45 with pectin substrate at optimal conditions (pH 5.0, 30°C)

    • Adding ruthenium red solution (0.05%)

    • Measuring absorbance at 535 nm

    • Calculating activity using a standard curve of de-methylesterified pectin

  • pH-stat titration: This method measures proton release during de-methylesterification:

    • Reaction is performed in a temperature-controlled vessel

    • pH is maintained constant by automated addition of NaOH

    • PME activity is calculated from the rate of NaOH consumption

  • Gel diffusion assay: Semi-quantitative method for rapid screening:

    • Pectin and ruthenium red are incorporated into agarose gels

    • Sample wells are loaded with PME45

    • Activity is visualized as red halos around sample wells

    • Halo diameter correlates with enzymatic activity

  • FTIR spectroscopy: For detailed characterization:

    • Measures changes in specific infrared absorption bands (1740-1760 cm⁻¹) corresponding to methyl ester bonds in pectin

    • Provides quantitative data on degree of methylesterification

For inhibition studies, PME45 activity can be assessed in the presence of potential inhibitors, followed by comparison with baseline activity using any of these methods .

How does pH affect the activity and inhibitory properties of PME45?

The pH-dependence of PME45 activity follows a pattern similar to other PME/PMEI proteins in Arabidopsis thaliana. Based on studies with related proteins:

  • Enzymatic activity: PME45 likely exhibits a bell-shaped pH activity curve with:

    • Optimal activity between pH 5.0-6.0

    • Significantly reduced activity below pH 4.0 and above pH 7.0

    • Complete inactivation at extreme pH values (<3.0 or >8.0)

  • Inhibitory function: The PMEI domain typically shows pH-dependent inhibition with:

    • Maximum inhibition at acidic pH (4.0-5.5)

    • Minimal inhibitory activity at neutral-to-alkaline pH (>7.0)

This pH sensitivity has significant implications for PME45 function in different plant tissues and developmental stages. In the apoplast (pH ~5.5), both the enzymatic and inhibitory activities would be present, while in alkaline conditions, inhibitory activity would be suppressed .

The pH-dependent activity profile creates a regulatory mechanism where changes in cell wall pH during development or stress responses can modulate PME45 function without requiring changes in protein abundance.

What is the role of PME45 in plant immunity and stress responses?

PME45, like other PMEs, likely plays a crucial role in plant immunity through modification of cell wall structure during pathogen invasion:

  • Pathogen-associated molecular pattern (PAMP) recognition: Changes in pectin methylesterification status can trigger immune responses by releasing oligogalacturonides (OGs) that act as damage-associated molecular patterns (DAMPs).

  • Regulation of cell wall porosity: PME45-mediated de-methylesterification alters cell wall porosity, potentially restricting pathogen entry and movement between cells.

  • Signaling cascade activation: PME45 activity may generate specific pectin patterns that activate defense-related signaling pathways.

Arabidopsis plants with mutations in various PME genes show impaired resistance to bacterial pathogens like Pseudomonas syringae, demonstrating the importance of this enzyme family in plant immunity .

The dual PME/PMEI function of PME45 may represent an evolved mechanism for rapid, fine-tuned responses to pathogen attack, allowing plants to quickly alter cell wall composition during infection without requiring de novo protein synthesis.

What approaches can be used to study PME45 function in vivo?

Multiple complementary approaches can be employed to investigate PME45 function in plants:

  • Genetic manipulation:

    • CRISPR/Cas9-mediated knockout or knockdown of PME45

    • Overexpression using constitutive (35S) or tissue-specific promoters

    • Expression of catalytically inactive mutants to study structural roles

  • Biochemical approaches:

    • Application of purified recombinant PME45 to seedlings to observe dose-dependent effects

    • Ruthenium red staining of tissue sections to visualize changes in pectin methylesterification

    • Immunolocalization using antibodies specific to PME45 or differentially methylesterified pectins (e.g., JIM5, JIM7)

  • Phenotypic analysis:

    • Root growth assays (primary root length, lateral root formation)

    • Cell expansion analysis in hypocotyls and leaves

    • Pathogen susceptibility tests

  • Structural analysis of cell walls:

    • Fourier-transform infrared spectroscopy (FTIR) to quantify methylesterification levels

    • Atomic force microscopy to assess changes in cell wall mechanical properties

    • Comprehensive microarray polymer profiling (CoMPP) to analyze multiple cell wall components simultaneously

Studies with related proteins have established a dose-dependent relationship between PMEI application and both homogalacturonan de-methylesterification and root growth, providing a framework for similar experiments with PME45 .

How can PME45 substrate specificity be determined experimentally?

Determining PME45 substrate specificity requires systematic testing against different pectin substrates with varying degrees and patterns of methylesterification:

  • Substrate preparation:

    • Commercial pectins with defined degrees of methylesterification (DM)

    • Extraction of native pectins from different plant tissues

    • Chemically modified pectins with controlled patterns of methylesterification

  • Activity assays:

    • Measure initial reaction velocities against each substrate using methods described in question 2.3

    • Determine kinetic parameters (Km, Vmax, kcat) for each substrate

    • Compare catalytic efficiency (kcat/Km) across substrates

  • Pattern analysis of reaction products:

    • Enzymatic fingerprinting using specific pectin lyases

    • Mass spectrometry of oligogalacturonides released

    • NMR spectroscopy to determine the distribution of de-methylesterified residues

  • Inhibition studies:

    • Test competitive inhibition by pectin fragments

    • Evaluate inhibition by specific PMEI proteins

    • Determine IC50 values for different inhibitors

From studies with other PMEs, we might expect PME45 to show a preference for either random de-methylesterification (typically associated with plant PMEs from Family 2) or blockwise de-methylesterification (typically associated with plant PMEs from Family 1), depending on its evolutionary history and physiological role .

How does PME45 compare structurally to other characterized plant PMEs?

PME45 shares key structural features with other plant PMEs while possessing unique characteristics:

FeaturePME45Typical Plant PMEsNotes
Signal peptidePresent (N-terminal)PresentTargets protein to secretory pathway
Pro-domain/PMEI domainPresentVariableFunctions in protein folding and auto-inhibition
Catalytic domainPresentPresentContains active site residues
Length609 amino acids400-600 amino acidsLarger than average due to extensive pro-domain
Isoelectric pointBasicVariableAffects interaction with acidic pectin substrate
Glycosylation sitesPredictedCommonMay affect stability and activity
Catalytic residuesConservedConservedAsp, Asp, Arg catalytic triad

The presence of both a PMEI-like domain and a PME domain suggests PME45 may have evolved a self-regulatory mechanism. This structural arrangement allows for potential intramolecular inhibition under certain conditions, distinguishing it from PMEs that lack this inhibitory domain .

What experimental approaches can determine the thermal stability of PME45?

Thermal stability of PME45 can be assessed using several complementary techniques:

  • Differential Scanning Calorimetry (DSC):

    • Measures heat capacity changes during protein unfolding

    • Provides thermodynamic parameters (Tm, ΔH, ΔCp)

    • Sample requirements: 0.5-1.0 mg purified protein

    • Protocol: Heat sample at 1°C/min from 20-90°C

  • Circular Dichroism (CD) Spectroscopy:

    • Monitors changes in secondary structure during thermal denaturation

    • Provides melting temperature (Tm) and conformational information

    • Sample requirements: 0.1-0.2 mg/mL protein in low-salt buffer

    • Protocol: Measure ellipticity at 222 nm during temperature increase

  • Thermal Shift Assay (TSA):

    • Uses fluorescent dyes that bind to hydrophobic regions exposed during unfolding

    • High-throughput compatible

    • Sample requirements: 5-10 μg protein with SYPRO Orange dye

    • Protocol: Increase temperature 1°C/min in real-time PCR instrument

  • Residual Activity Assays:

    • Incubate protein at different temperatures for set time periods

    • Measure remaining enzymatic activity

    • Calculate half-life at each temperature

    • Determine activation energy for denaturation using Arrhenius plot

Based on studies with related PMEIs, PME45 is expected to show remarkable heat stability, likely retaining significant activity even after exposure to temperatures above 70°C for short periods . This stability profile is important for experimental design, as it suggests that heat treatment may not be suitable for inactivating PME45 in experimental controls.

How do post-translational modifications affect PME45 activity?

Post-translational modifications (PTMs) significantly impact PME45 function through several mechanisms:

  • N-glycosylation:

    • Predicted sites: Asn residues in N-X-S/T motifs

    • Effects: Enhances protein stability, affects secretion efficiency

    • Detection method: PNGase F treatment followed by mobility shift analysis

    • Functional impact: Likely necessary for proper folding and secretion to the cell wall

  • Proteolytic processing:

    • The pro-domain (PMEI-like region) is potentially removed during protein maturation

    • Processing may occur in the Golgi apparatus or apoplast

    • Detection: N-terminal sequencing of mature protein from cell walls

    • Impact: Removal may activate the enzyme by eliminating auto-inhibition

  • Phosphorylation:

    • Potential sites: Ser/Thr residues, particularly in the N-terminal region

    • Detection: Phospho-specific antibodies or mass spectrometry

    • Function: May regulate enzyme activity or protein-protein interactions

    • Signaling context: Could link PME45 activity to stress response pathways

  • Oxidative modifications:

    • Cysteine residues may form disulfide bonds or undergo oxidation

    • Impact: Affects protein stability and activity under oxidative stress

    • Detection: Mass spectrometry under non-reducing conditions

The production of recombinant PME45 in E. coli (which lacks glycosylation machinery) versus P. pastoris (which performs eukaryotic-type glycosylation) can result in proteins with different activities, highlighting the importance of PTMs for proper function .

What is the significance of PME45 in cell wall remodeling during development?

PME45, like other PME/PMEI proteins, likely plays a crucial role in developmental processes requiring controlled cell wall remodeling:

  • Cell expansion regulation:

    • De-methylesterification by PME45 can promote either cell wall loosening or stiffening, depending on calcium concentration and pH

    • In growing tissues, blockwise de-methylesterification creates calcium cross-linked "egg-box" structures that can limit cell expansion

    • Pattern of de-methylesterification (random vs. blockwise) determines mechanical outcomes

  • Developmental stage-specific activity:

    • Expression patterns suggest involvement in specific developmental processes

    • Likely contributes to cell differentiation by modifying local cell wall properties

    • May establish tissue-specific mechanical properties through differential activity

  • Interaction with other cell wall modifying enzymes:

    • Creates substrates for polygalacturonases and pectate lyases

    • Works in concert with expansins during cell expansion

    • May coordinate with cellulose synthases to maintain cell wall integrity during growth

  • Root development impact:

    • Application of PMEIs to Arabidopsis seedlings shows dose-dependent inhibition of root growth

    • Affects both cell division and expansion in root tissues

    • Important for lateral root emergence through localized cell wall loosening

Experimental data with PMEI3 demonstrates that exogenous application of PME inhibitors results in dose-dependent effects on homogalacturonan de-methylesterification and subsequent root growth, suggesting PME45 may have similar developmental importance .

What are common pitfalls in PME45 activity assays and how can they be avoided?

Researchers commonly encounter several challenges when assessing PME45 activity:

ChallengeCauseSolution
Low or inconsistent activityProtein denaturation during purificationAdd stabilizing agents (glycerol, trehalose) to all buffers
Improper pH conditionsTest activity across pH range 4.0-7.0
Metal ion interferenceInclude EDTA in reaction buffer to chelate contaminating ions
High background in colorimetric assaysNon-specific dye bindingInclude proper controls with heat-inactivated enzyme
Interfering compounds in plant extractsUse size exclusion or ion exchange chromatography to remove interfering compounds
Poor reproducibilityInconsistent substrate qualityUse well-characterized commercial pectins with defined DM
Temperature fluctuationsMaintain strict temperature control during assays
No detectable activity with recombinant proteinImproper folding in expression systemTry alternative expression systems (P. pastoris, insect cells)
Missing co-factorsSupplement reaction with various divalent cations (Ca²⁺, Mg²⁺)
Inhibition by buffer componentsIncompatible buffer substancesTest activity in different buffer systems (citrate, phosphate, MES)

Additional recommendations:

  • Always include positive controls using commercial PME preparations

  • Use freshly prepared substrate solutions

  • Consider the possible competitive inhibition by the pro-domain when using full-length recombinant PME45

How can PME45 function be investigated in complex cell wall environments?

Studying PME45 in complex cell wall environments requires specialized approaches:

  • In situ enzymatic assays:

    • Tissue printing on pectin-containing membranes

    • Fluorescent-labeled substrate incubation with tissue sections

    • Analysis of native cell wall samples using FTIR microscopy

  • Immunocytochemical approaches:

    • Use of monoclonal antibodies specific to PME45

    • Antibodies that recognize differentially methylesterified pectins (JIM5, JIM7, LM19, LM20)

    • Correlative light and electron microscopy for high-resolution localization

  • Genetic approaches for in vivo studies:

    • PME45 promoter-reporter fusions to study expression patterns

    • Conditional expression systems (inducible promoters)

    • Cell-type specific complementation of pme45 mutants

  • Biochemical extraction and analysis of modified pectins:

    • Sequential extraction of cell wall components

    • Analysis of degree of methylesterification in different wall fractions

    • Comparison between wild-type and PME45 mutant/overexpression lines

  • Live cell imaging approaches:

    • Fluorescently tagged PME45 to monitor subcellular localization

    • FRET-based biosensors for detecting changes in pectin structure

    • pH-sensitive fluorescent proteins to monitor apoplastic pH changes

These approaches can be combined to build a comprehensive understanding of how PME45 functions within the complex matrix of plant cell walls during development and stress responses .

What experimental controls are essential when studying PME45 expression and activity?

Rigorous experimental design for PME45 studies requires multiple types of controls:

  • For gene expression studies:

    • Multiple reference genes for qRT-PCR normalization (e.g., ACTIN2, UBQ10, EF1α)

    • Tissue-specific expression analysis using reporter genes (GUS, GFP)

    • Negative controls lacking reverse transcriptase to detect genomic DNA contamination

    • Positive controls using constitutively expressed genes

  • For protein activity assays:

    • Heat-inactivated PME45 (100°C for 10 minutes) as negative control

    • Commercial PME preparations as positive control

    • Buffer-only controls to establish baseline measurements

    • Substrate-only controls to account for spontaneous de-methylesterification

  • For in vivo functional studies:

    • Multiple independent transgenic/mutant lines to control for position effects

    • Empty vector controls for transformation experiments

    • Complementation of knockout lines with wild-type PME45 to confirm specificity

    • Catalytically inactive PME45 variants to distinguish enzymatic from structural roles

  • For inhibitor studies:

    • Concentration gradients to establish dose-response relationships

    • Time-course experiments to determine kinetics

    • Control inhibitors with known effects on PME activity (e.g., PMEI3)

    • Controls to rule out non-specific effects on cell viability

  • Statistical considerations:

    • Minimum of 3 biological replicates

    • Appropriate statistical tests based on data distribution

    • Power analysis to determine sample size requirements

    • Randomization and blinding where applicable

These controls ensure that experimental observations can be confidently attributed to PME45 function rather than to experimental artifacts or non-specific effects .

What emerging technologies could advance PME45 research?

Several cutting-edge technologies show promise for advancing our understanding of PME45 function:

  • Single-molecule enzymology:

    • Real-time visualization of individual PME45 molecules interacting with pectin substrates

    • Atomic force microscopy to detect local changes in cell wall mechanics

    • Single-molecule FRET to study conformational changes during catalysis

  • CRISPR-based technologies:

    • Base editing for introducing specific mutations without double-strand breaks

    • CRISPRi for tissue-specific or inducible knockdown of PME45

    • Prime editing for precise modification of PME45 residues

  • Advanced imaging approaches:

    • Super-resolution microscopy for nanoscale visualization of PME45 localization

    • Expansion microscopy to physically enlarge cell wall structures

    • Label-free imaging using stimulated Raman scattering microscopy

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Machine learning algorithms to identify patterns in cell wall modification data

    • Network analysis to understand PME45 in the context of cell wall remodeling pathways

  • Synthetic biology approaches:

    • Designer PME variants with altered substrate specificity or pH optima

    • Optogenetic control of PME45 activity for spatiotemporal manipulation

    • Cell-free systems for high-throughput screening of PME variants

These technologies could help resolve long-standing questions about the specific roles of PME45 in development and stress responses, as well as the molecular mechanisms underlying its dual PME/PMEI functionality .

How might PME45 research contribute to agricultural applications?

Understanding PME45 function has several potential applications in agriculture:

  • Enhanced stress resistance:

    • Engineering PME45 expression for improved pathogen resistance

    • Modifying pectin methylesterification patterns to enhance drought tolerance

    • Developing crops with optimized cell wall composition for environmental resilience

  • Improved growth characteristics:

    • Fine-tuning PME45 activity to enhance biomass production

    • Modifying root architecture through targeted PME45 expression

    • Controlling fruit ripening and shelf-life through pectin metabolism regulation

  • Bioenergy applications:

    • Optimizing cell wall composition for more efficient biofuel production

    • Reducing recalcitrance to enzymatic degradation in bioenergy crops

    • Engineering plants with easily extractable cell wall polysaccharides

  • Marker-assisted selection:

    • Identifying natural PME45 variants associated with beneficial traits

    • Developing molecular markers for breeding programs

    • Selecting optimal PME/PMEI balance for specific crop applications

  • Biotechnological products:

    • Using recombinant PME45 for production of tailored pectins

    • Developing PME inhibitors as tools for controlling fruit softening

    • Creating PME-based biosensors for monitoring plant stress responses

These applications highlight the potential translational impact of fundamental research on PME45 and related cell wall modifying enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.