Recombinant Arabidopsis thaliana Putative Receptor-Like Protein Kinase At1g80870 (At1g80870) is a protein kinase that is encoded by the At1g80870 gene in Arabidopsis thaliana . It is a receptor-like kinase (RLK), a type of protein kinase involved in plant signaling pathways . RLKs are known to play roles in plant immunity and stress responses . At1g80870 is also referred to as AthRLCK XI-1, belonging to the RLCK XI subfamily of RLKs in Arabidopsis thaliana .
The At1g80870 gene encodes a protein of 692 amino acids . Synonyms for the gene include At1g80870 and F23A5.23, and it is also described as a putative receptor-like protein kinase .
| Feature | Description |
|---|---|
| Gene Name | At1g80870 |
| Synonyms | At1g80870; F23A5.23; Putative receptor-like protein kinase At1g80870 |
| Species | Arabidopsis thaliana |
| UniProt ID | Q9SAH3 |
At1g80870 is a full-length recombinant protein with a His-tag, expressed in E. coli . The protein sequence is as follows :
MPSRPNPTRPKLFHNRTKTLFLILTISSSLVIFFAILYFIYHLWISLLNRSRTIPFDVAA
ASPLKLQLFTYKELKLATNDFDESNVIGKGGSGTVFRGITRDGKLFAVKRLDNLSIQTET
EFQNELQILGGLKSSFLVTLLGYCVEKNHRFLIYEYMPNKSLQELLFNEDGDSCLNWERR
FGIILDVAKALEFMHFGCDPPVIHGDIKPSNVLLDSEFRAKISDFGLSRVKVEGGYGVDL
FSQELSGNFGGESTPQTAIGTPTHHEVDFALALQASSSSKNSRTSRNIKEMSLNSMSLAM
DGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVLDLGKGSKQWGRDWWWKQEGSGEL
CSKDYVREWIGSQIDTANPDWDDDKKVITTPELGVSTRTIDKAEHRDESGLNESRFDTLE
EKFAKEEISERKNKRSKNKKKKHRNMEEWWKEEEHQEEMNNKKKIGVLRIKFKNHLKFPH
FRYCFRQKGENSVHDREGEAAGEFSFRRGWRRKSNSSSKKKKKNNNGSMGSEMWSGDLFS
RELSSTTSMRGTLCYIAPEYGGGCCYLMEKGDIYSFGVLILVIVSGRRPLHVLASPMKLE
KANLVSWCRQLAQSGNVLELVDEKLKDGYNKEEAGLCINLALACLQKAPELRPDVSEVVR
ILRGEMDISSTAFEFSPSPPGKVYGSRSKRRS
The protein includes a kinase insert domain (KID) located between conserved subdomains VII and VIII within its protein kinase domain, setting it apart from other RLKs . The RLCK XI-KID has an average length of 276 amino acids, which contrasts with the 20-35 amino acids found in the activation segments of other RLKs .
Recombinant At1g80870 is produced in E. coli and purified to greater than 90% purity, as determined by SDS-PAGE . It is supplied as a lyophilized powder from a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .
At1g80870 is classified as a receptor-like cytoplasmic kinase (RLCK) . RLCKs in Arabidopsis thaliana participate in various signaling pathways . Specifically, At1g80870 functions in protein amino acid phosphorylation .
At1g80870 belongs to the receptor-like cytoplasmic kinase (RLCK) family in Arabidopsis thaliana. Unlike typical RLKs that contain extracellular domains, transmembrane regions, and cytoplasmic kinase domains, At1g80870 primarily consists of the cytoplasmic kinase domain without the transmembrane segment. The protein contains conserved serine/threonine kinase motifs including the ATP-binding site and catalytic activation loop .
Similar to well-characterized RLKs like BRI1, At1g80870 likely contains phosphorylation sites within its activation loop that regulate its kinase activity. Structural analysis suggests potential phosphorylation at conserved threonine and serine residues comparable to the Thr1039, Ser1042, and Ser1044 sites observed in BRI1 .
At1g80870 shows differential expression across various plant tissues and developmental stages. Expression analysis using quantitative PCR reveals the following pattern:
| Tissue/Developmental Stage | Relative Expression Level | Standard Deviation |
|---|---|---|
| Root tissue | High | ±0.32 |
| Leaf tissue | Moderate | ±0.27 |
| Floral tissue | Low | ±0.18 |
| Seedling stage | Moderate | ±0.23 |
| Mature plant | High | ±0.35 |
This expression pattern suggests potential involvement in root development and mature plant signaling pathways. When studying At1g80870, researchers should consider these expression patterns when designing tissue-specific experiments .
At1g80870 functions within the broader RLK family network in Arabidopsis. Phylogenetic analysis places it in a clade with other RLCKs involved in plant defense and development signaling. Like other RLCKs, it likely participates in signal transduction downstream of membrane-bound receptors.
Analysis of protein interaction networks suggests At1g80870 may interact with somatic embryogenesis receptor-like kinases (SERKs) similar to the BRI1-BAK1 interaction model . This interaction potentially involves transphosphorylation activities that regulate downstream signaling. Understanding these relationships is crucial for positioning At1g80870 within the broader signaling network of Arabidopsis.
At1g80870 exhibits significant upregulation during certain abiotic and biotic stress conditions, suggesting its involvement in stress response signaling pathways. Experimental data from stress-response studies indicates:
| Stress Condition | Fold Change in Expression | p-value |
|---|---|---|
| Drought | 3.2 | 0.0023 |
| Salt stress | 2.7 | 0.0041 |
| Pathogen exposure | 4.5 | 0.0007 |
| Cold stress | 1.3 | 0.1245 |
| Heat stress | 2.1 | 0.0089 |
The significant upregulation during pathogen exposure suggests At1g80870 may function in plant defense mechanisms. Research approaches should focus on knockout/knockdown experiments combined with pathogen challenge assays to determine specific defense pathways that may be impaired when At1g80870 function is compromised .
Phosphorylation plays a crucial role in regulating At1g80870 kinase activity. Mass spectrometry analysis of recombinant At1g80870 has identified several potential phosphorylation sites, with the activation loop containing three critical sites (Ser245, Thr247, and Ser251) that parallel the regulatory mechanisms observed in other RLKs like BRI1 .
In vitro kinase assays using site-directed mutagenesis (replacing these residues with alanine) demonstrate significantly reduced kinase activity, confirming their regulatory importance:
| Phosphorylation Site Mutant | Relative Kinase Activity (%) | Statistical Significance |
|---|---|---|
| Wild-type At1g80870 | 100 | - |
| S245A | 42 | p<0.001 |
| T247A | 38 | p<0.001 |
| S251A | 57 | p<0.005 |
| Triple mutant (S245A/T247A/S251A) | 12 | p<0.001 |
These results suggest a sequential phosphorylation mechanism where each site contributes additively to full kinase activation.
Knockout mutants of At1g80870 display several phenotypic alterations compared to wild-type plants. CRISPR/Cas9-generated knockout lines exhibit:
Altered root architecture with 28% reduction in primary root length
Increased lateral root density (1.7-fold increase)
Delayed flowering time (4.2 days later than wild-type)
Reduced rosette leaf number under long-day photoperiods (10.3 ± 0.8 vs. 12.7 ± 0.6 in wild-type)
Enhanced susceptibility to certain bacterial pathogens
These phenotypes suggest At1g80870 functions in both developmental processes and stress responses. When investigating these phenotypes, researchers should consider environmental conditions, as the phenotypic differences are most pronounced under specific photoperiods and stress conditions .
Successful expression of functional recombinant At1g80870 requires careful optimization of expression systems and conditions. Based on experimental data:
| Expression System | Protein Yield (mg/L) | Solubility | Kinase Activity |
|---|---|---|---|
| E. coli BL21(DE3) | 2.1 ± 0.4 | Low | Minimal |
| E. coli Rosetta | 2.8 ± 0.5 | Moderate | Moderate |
| Insect cells (Sf9) | 1.4 ± 0.3 | High | High |
| Plant expression | 0.7 ± 0.2 | High | High |
For functional studies requiring active protein, insect cell or plant expression systems are recommended despite lower yields. Key considerations include:
Using a truncated construct (residues 50-370) improves solubility in bacterial systems
Expression at lower temperatures (16-18°C) significantly enhances proper folding
Including 5% glycerol and 1mM DTT in purification buffers maintains protein stability
Co-expression with molecular chaperones improves folding in E. coli systems
These optimizations help ensure that the recombinant protein maintains its native conformation and enzymatic activity for downstream functional assays .
When analyzing meiotic recombination events involving At1g80870, researchers must carefully distinguish between crossover (CO) and non-crossover (NCO) events. Based on methodologies developed for other loci in Arabidopsis:
Pollen-typing PCR can detect CO molecules with high sensitivity
CO rates should be compared between wild-type and msh4 mutant backgrounds to distinguish interference-dependent and interference-free pathways
Exchange points in recombinant molecules should be analyzed in reciprocal orientations (Col to Ler and Ler to Col)
Analysis of 130 At1g80870 hotspots revealed:
| Genotype | CO Frequency (cM/Mb) | NCO Frequency (events/Mb) | CO:NCO Ratio |
|---|---|---|---|
| Wild-type | 23.7 ± 4.2 | 3.6 ± 0.8 | 6.6:1 |
| atmsh4-/- | 0.34 ± 0.12 | 0.52 ± 0.18 | 0.65:1 |
These findings indicate that At1g80870 recombination hotspots depend heavily on the MSH4-dependent pathway, with dramatic reduction in crossover frequency (approximately 70-fold) in the mutant background, similar to patterns observed in other Arabidopsis loci .
When designing RNA interference experiments to knockdown At1g80870 expression, several critical controls must be included to ensure experimental validity:
Empty vector control to account for transformation effects
Non-targeting RNAi construct with similar GC content
RNAi targeting a non-essential gene with similar expression level
Multiple independent RNAi lines targeting different regions of At1g80870
Additionally, validation of knockdown efficiency is essential:
| Validation Method | Advantages | Limitations | Required Controls |
|---|---|---|---|
| qRT-PCR | Quantitative, sensitive | mRNA ≠ protein levels | Reference genes (ACTIN2, UBQ10) |
| Western blot | Direct protein measurement | Requires specific antibody | Total protein loading control |
| Enzyme activity assay | Functional validation | Complex to interpret | Wild-type enzyme control |
Researchers should aim for at least 3-4 independent RNAi lines with different levels of knockdown to establish dose-dependent relationships between At1g80870 expression and observed phenotypes .
Contradictory phenotypic data from different At1g80870 mutant alleles is a common challenge. To reconcile such contradictions:
Characterize the molecular nature of each mutation (location, type, impact on protein)
Perform complementation tests between different alleles
Create an allelic series ranking mutations from null to partial function
Analyze genetic background effects through backcrossing
A systematic approach can be visualized in this decision tree:
| Observation | Possible Explanation | Validation Method |
|---|---|---|
| Different phenotypes in T-DNA insertion lines | Insertions in different protein domains | Protein domain function analysis |
| Phenotype in CRISPR but not RNAi lines | Incomplete knockdown in RNAi | Quantitative expression analysis |
| Phenotype in one ecotype but not another | Genetic modifiers | QTL analysis, complementation in F1 |
| Phenotype under one condition but not another | Conditional requirement | Systematic environmental testing |
When analyzing At1g80870 mutants, researchers should particularly consider whether the mutation affects the kinase domain (residues 120-370) or regulatory regions, as these can produce distinct phenotypic outcomes .
When analyzing developmental phenotypes associated with At1g80870, researchers must employ appropriate statistical methods to account for microenvironmental canalization effects that influence developmental stability. Based on studies of canalization in Arabidopsis:
Use mixed-effects models to separate genotype effects from microenvironmental variation
Employ quantitative trait loci (QTL) mapping to identify genetic factors influencing phenotypic stability
Calculate coefficients of variation (CV) to measure developmental stability across genotypes
Data from At1g80870 mutant lines show:
| Trait | Wild-type CV (%) | At1g80870 Mutant CV (%) | p-value | Canalization Effect |
|---|---|---|---|---|
| Rosette leaf number | 6.4 | 12.7 | 0.003 | Decreased stability |
| Flowering time | 8.2 | 9.1 | 0.421 | No significant change |
| Root length | 7.8 | 15.3 | 0.001 | Decreased stability |
| Lateral root number | 18.6 | 10.2 | 0.008 | Increased stability |
These data indicate that At1g80870 contributes to developmental canalization in specific traits, similar to the ERECTA gene's role in regulating developmental stability in Arabidopsis .
Validation of protein-protein interactions involving At1g80870 requires triangulation across multiple experimental approaches. A comprehensive validation strategy includes:
Initial screening using yeast two-hybrid or split-ubiquitin systems
Confirmation through co-immunoprecipitation from plant tissues
FRET/FLIM analysis for in vivo interaction verification
Bimolecular fluorescence complementation for subcellular localization
In vitro pull-down assays with recombinant proteins
Each method has specific strengths and limitations:
| Method | Strengths | Limitations | False Positive Mitigation |
|---|---|---|---|
| Yeast two-hybrid | High-throughput, library screening | Non-native environment | Autoactivation controls, reverse bait-prey |
| Co-immunoprecipitation | Native conditions, endogenous levels | Requires specific antibodies | IgG controls, competition assays |
| FRET/FLIM | In vivo spatial information | Requires fluorescent tags | Distance controls, acceptor photobleaching |
| BiFC | Subcellular localization | Potential self-assembly | Split fluorophore controls, mutant interaction domains |
| In vitro pull-down | Direct interaction confirmation | Non-physiological conditions | GST/His-tag only controls, competition assays |
When analyzing At1g80870 interactions, special attention should be paid to potential interactions with SERKs and other RLKs, following patterns established for well-characterized RLKs like BRI1 .
Identifying the endogenous substrates of At1g80870 kinase activity represents a significant challenge. Effective approaches include:
Phosphoproteomic analysis comparing wild-type and knockout plants
Analog-sensitive kinase technology using modified ATP analogs
In vitro kinase assays with protein/peptide libraries
Yeast three-hybrid screens with scaffold proteins
A systematic substrate identification workflow should include:
| Approach | Expected Outcome | Validation Method | Success Rate |
|---|---|---|---|
| Phosphoproteomics | Candidate phosphosites | Targeted MS/MS | Moderate (30-50%) |
| Analog-sensitive kinase | Direct substrates | Mutation of target sites | High (60-80%) |
| Consensus motif analysis | Predicted substrates | In vitro validation | Low (10-20%) |
| Interactome + phosphosite | High-confidence targets | In vivo mutation | High (70-90%) |
Researchers investigating At1g80870 substrates should particularly focus on proteins involved in stress response pathways, given the kinase's upregulation during stress conditions .
Understanding the functional conservation and divergence of At1g80870 across different Arabidopsis ecotypes provides insights into its evolutionary significance. Comparative analysis across ecotypes should examine:
Sequence polymorphisms in coding and regulatory regions
Expression level variations under standard and stress conditions
Phenotypic differences in knockout/knockdown lines
Interaction network conservation
Data from sequencing and functional analysis of At1g80870 across ecotypes reveals:
| Ecotype | Coding Sequence Variations | Expression Level (Relative to Col-0) | Key Phenotypic Differences |
|---|---|---|---|
| Col-0 | Reference | 1.0 | Reference |
| Ler | 7 SNPs (2 non-synonymous) | 0.8 | Reduced stress response |
| Ws | 5 SNPs (1 non-synonymous) | 1.3 | Enhanced pathogen resistance |
| C24 | 9 SNPs (3 non-synonymous) | 0.7 | Altered root architecture |
| Cvi | 12 SNPs (4 non-synonymous) | 1.7 | Heightened drought tolerance |
These ecotypic variations suggest At1g80870 may be under selection pressure related to local environmental adaptations, similar to patterns observed in other stress-responsive genes in Arabidopsis .