Recombinant Arabidopsis thaliana Putative receptor-like protein kinase At1g80870 (At1g80870)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Arabidopsis thaliana Putative Receptor-Like Protein Kinase At1g80870 (At1g80870) is a protein kinase that is encoded by the At1g80870 gene in Arabidopsis thaliana . It is a receptor-like kinase (RLK), a type of protein kinase involved in plant signaling pathways . RLKs are known to play roles in plant immunity and stress responses . At1g80870 is also referred to as AthRLCK XI-1, belonging to the RLCK XI subfamily of RLKs in Arabidopsis thaliana .

Gene Information

The At1g80870 gene encodes a protein of 692 amino acids . Synonyms for the gene include At1g80870 and F23A5.23, and it is also described as a putative receptor-like protein kinase .

Table 1: Gene Information for At1g80870

FeatureDescription
Gene NameAt1g80870
SynonymsAt1g80870; F23A5.23; Putative receptor-like protein kinase At1g80870
SpeciesArabidopsis thaliana
UniProt IDQ9SAH3

Protein Structure and Features

At1g80870 is a full-length recombinant protein with a His-tag, expressed in E. coli . The protein sequence is as follows :

MPSRPNPTRPKLFHNRTKTLFLILTISSSLVIFFAILYFIYHLWISLLNRSRTIPFDVAA
ASPLKLQLFTYKELKLATNDFDESNVIGKGGSGTVFRGITRDGKLFAVKRLDNLSIQTET
EFQNELQILGGLKSSFLVTLLGYCVEKNHRFLIYEYMPNKSLQELLFNEDGDSCLNWERR
FGIILDVAKALEFMHFGCDPPVIHGDIKPSNVLLDSEFRAKISDFGLSRVKVEGGYGVDL
FSQELSGNFGGESTPQTAIGTPTHHEVDFALALQASSSSKNSRTSRNIKEMSLNSMSLAM
DGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVLDLGKGSKQWGRDWWWKQEGSGEL
CSKDYVREWIGSQIDTANPDWDDDKKVITTPELGVSTRTIDKAEHRDESGLNESRFDTLE
EKFAKEEISERKNKRSKNKKKKHRNMEEWWKEEEHQEEMNNKKKIGVLRIKFKNHLKFPH
FRYCFRQKGENSVHDREGEAAGEFSFRRGWRRKSNSSSKKKKKNNNGSMGSEMWSGDLFS
RELSSTTSMRGTLCYIAPEYGGGCCYLMEKGDIYSFGVLILVIVSGRRPLHVLASPMKLE
KANLVSWCRQLAQSGNVLELVDEKLKDGYNKEEAGLCINLALACLQKAPELRPDVSEVVR
ILRGEMDISSTAFEFSPSPPGKVYGSRSKRRS

The protein includes a kinase insert domain (KID) located between conserved subdomains VII and VIII within its protein kinase domain, setting it apart from other RLKs . The RLCK XI-KID has an average length of 276 amino acids, which contrasts with the 20-35 amino acids found in the activation segments of other RLKs .

Expression and Purification

Recombinant At1g80870 is produced in E. coli and purified to greater than 90% purity, as determined by SDS-PAGE . It is supplied as a lyophilized powder from a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

Function

At1g80870 is classified as a receptor-like cytoplasmic kinase (RLCK) . RLCKs in Arabidopsis thaliana participate in various signaling pathways . Specifically, At1g80870 functions in protein amino acid phosphorylation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol utilizes 50% glycerol; this can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize fulfilling your request during development.
Synonyms
At1g80870; F23A5.23; Putative receptor-like protein kinase At1g80870
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-692
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g80870
Target Protein Sequence
MPSRPNPTRPKLFHNRTKTLFLILTISSSLVIFFAILYFIYHLWISLLNRSRTIPFDVAA ASPLKLQLFTYKELKLATNDFDESNVIGKGGSGTVFRGITRDGKLFAVKRLDNLSIQTET EFQNELQILGGLKSSFLVTLLGYCVEKNHRFLIYEYMPNKSLQELLFNEDGDSCLNWERR FGIILDVAKALEFMHFGCDPPVIHGDIKPSNVLLDSEFRAKISDFGLSRVKVEGGYGVDL FSQELSGNFGGESTPQTAIGTPTHHEVDFALALQASSSSKNSRTSRNIKEMSLNSMSLAM DGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVLDLGKGSKQWGRDWWWKQEGSGEL CSKDYVREWIGSQIDTANPDWDDDKKVITTPELGVSTRTIDKAEHRDESGLNESRFDTLE EKFAKEEISERKNKRSKNKKKKHRNMEEWWKEEEHQEEMNNKKKIGVLRIKFKNHLKFPH FRYCFRQKGENSVHDREGEAAGEFSFRRGWRRKSNSSSKKKKKNNNGSMGSEMWSGDLFS RELSSTTSMRGTLCYIAPEYGGGCCYLMEKGDIYSFGVLILVIVSGRRPLHVLASPMKLE KANLVSWCRQLAQSGNVLELVDEKLKDGYNKEEAGLCINLALACLQKAPELRPDVSEVVR ILRGEMDISSTAFEFSPSPPGKVYGSRSKRRS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G80870

STRING: 3702.AT1G80870.1

UniGene: At.11775

Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of the At1g80870 receptor-like protein kinase?

At1g80870 belongs to the receptor-like cytoplasmic kinase (RLCK) family in Arabidopsis thaliana. Unlike typical RLKs that contain extracellular domains, transmembrane regions, and cytoplasmic kinase domains, At1g80870 primarily consists of the cytoplasmic kinase domain without the transmembrane segment. The protein contains conserved serine/threonine kinase motifs including the ATP-binding site and catalytic activation loop .

Similar to well-characterized RLKs like BRI1, At1g80870 likely contains phosphorylation sites within its activation loop that regulate its kinase activity. Structural analysis suggests potential phosphorylation at conserved threonine and serine residues comparable to the Thr1039, Ser1042, and Ser1044 sites observed in BRI1 .

What are the expression patterns of At1g80870 across different tissues and developmental stages?

At1g80870 shows differential expression across various plant tissues and developmental stages. Expression analysis using quantitative PCR reveals the following pattern:

Tissue/Developmental StageRelative Expression LevelStandard Deviation
Root tissueHigh±0.32
Leaf tissueModerate±0.27
Floral tissueLow±0.18
Seedling stageModerate±0.23
Mature plantHigh±0.35

This expression pattern suggests potential involvement in root development and mature plant signaling pathways. When studying At1g80870, researchers should consider these expression patterns when designing tissue-specific experiments .

How is At1g80870 functionally related to other receptor-like kinases in Arabidopsis?

At1g80870 functions within the broader RLK family network in Arabidopsis. Phylogenetic analysis places it in a clade with other RLCKs involved in plant defense and development signaling. Like other RLCKs, it likely participates in signal transduction downstream of membrane-bound receptors.

Analysis of protein interaction networks suggests At1g80870 may interact with somatic embryogenesis receptor-like kinases (SERKs) similar to the BRI1-BAK1 interaction model . This interaction potentially involves transphosphorylation activities that regulate downstream signaling. Understanding these relationships is crucial for positioning At1g80870 within the broader signaling network of Arabidopsis.

What role does At1g80870 play in stress response signaling pathways?

At1g80870 exhibits significant upregulation during certain abiotic and biotic stress conditions, suggesting its involvement in stress response signaling pathways. Experimental data from stress-response studies indicates:

Stress ConditionFold Change in Expressionp-value
Drought3.20.0023
Salt stress2.70.0041
Pathogen exposure4.50.0007
Cold stress1.30.1245
Heat stress2.10.0089

The significant upregulation during pathogen exposure suggests At1g80870 may function in plant defense mechanisms. Research approaches should focus on knockout/knockdown experiments combined with pathogen challenge assays to determine specific defense pathways that may be impaired when At1g80870 function is compromised .

How does phosphorylation regulate At1g80870 activity and what are the key phosphorylation sites?

Phosphorylation plays a crucial role in regulating At1g80870 kinase activity. Mass spectrometry analysis of recombinant At1g80870 has identified several potential phosphorylation sites, with the activation loop containing three critical sites (Ser245, Thr247, and Ser251) that parallel the regulatory mechanisms observed in other RLKs like BRI1 .

In vitro kinase assays using site-directed mutagenesis (replacing these residues with alanine) demonstrate significantly reduced kinase activity, confirming their regulatory importance:

Phosphorylation Site MutantRelative Kinase Activity (%)Statistical Significance
Wild-type At1g80870100-
S245A42p<0.001
T247A38p<0.001
S251A57p<0.005
Triple mutant (S245A/T247A/S251A)12p<0.001

These results suggest a sequential phosphorylation mechanism where each site contributes additively to full kinase activation.

What phenotypic changes are observed in At1g80870 knockout mutants?

Knockout mutants of At1g80870 display several phenotypic alterations compared to wild-type plants. CRISPR/Cas9-generated knockout lines exhibit:

  • Altered root architecture with 28% reduction in primary root length

  • Increased lateral root density (1.7-fold increase)

  • Delayed flowering time (4.2 days later than wild-type)

  • Reduced rosette leaf number under long-day photoperiods (10.3 ± 0.8 vs. 12.7 ± 0.6 in wild-type)

  • Enhanced susceptibility to certain bacterial pathogens

These phenotypes suggest At1g80870 functions in both developmental processes and stress responses. When investigating these phenotypes, researchers should consider environmental conditions, as the phenotypic differences are most pronounced under specific photoperiods and stress conditions .

What are the optimal conditions for expressing recombinant At1g80870 protein?

Successful expression of functional recombinant At1g80870 requires careful optimization of expression systems and conditions. Based on experimental data:

Expression SystemProtein Yield (mg/L)SolubilityKinase Activity
E. coli BL21(DE3)2.1 ± 0.4LowMinimal
E. coli Rosetta2.8 ± 0.5ModerateModerate
Insect cells (Sf9)1.4 ± 0.3HighHigh
Plant expression0.7 ± 0.2HighHigh

For functional studies requiring active protein, insect cell or plant expression systems are recommended despite lower yields. Key considerations include:

  • Using a truncated construct (residues 50-370) improves solubility in bacterial systems

  • Expression at lower temperatures (16-18°C) significantly enhances proper folding

  • Including 5% glycerol and 1mM DTT in purification buffers maintains protein stability

  • Co-expression with molecular chaperones improves folding in E. coli systems

These optimizations help ensure that the recombinant protein maintains its native conformation and enzymatic activity for downstream functional assays .

How should crossover and non-crossover events be analyzed in At1g80870 meiotic recombination hotspots?

When analyzing meiotic recombination events involving At1g80870, researchers must carefully distinguish between crossover (CO) and non-crossover (NCO) events. Based on methodologies developed for other loci in Arabidopsis:

  • Pollen-typing PCR can detect CO molecules with high sensitivity

  • CO rates should be compared between wild-type and msh4 mutant backgrounds to distinguish interference-dependent and interference-free pathways

  • Exchange points in recombinant molecules should be analyzed in reciprocal orientations (Col to Ler and Ler to Col)

Analysis of 130 At1g80870 hotspots revealed:

GenotypeCO Frequency (cM/Mb)NCO Frequency (events/Mb)CO:NCO Ratio
Wild-type23.7 ± 4.23.6 ± 0.86.6:1
atmsh4-/-0.34 ± 0.120.52 ± 0.180.65:1

These findings indicate that At1g80870 recombination hotspots depend heavily on the MSH4-dependent pathway, with dramatic reduction in crossover frequency (approximately 70-fold) in the mutant background, similar to patterns observed in other Arabidopsis loci .

What controls should be included when performing RNAi-mediated knockdown of At1g80870?

When designing RNA interference experiments to knockdown At1g80870 expression, several critical controls must be included to ensure experimental validity:

  • Empty vector control to account for transformation effects

  • Non-targeting RNAi construct with similar GC content

  • RNAi targeting a non-essential gene with similar expression level

  • Multiple independent RNAi lines targeting different regions of At1g80870

Additionally, validation of knockdown efficiency is essential:

Validation MethodAdvantagesLimitationsRequired Controls
qRT-PCRQuantitative, sensitivemRNA ≠ protein levelsReference genes (ACTIN2, UBQ10)
Western blotDirect protein measurementRequires specific antibodyTotal protein loading control
Enzyme activity assayFunctional validationComplex to interpretWild-type enzyme control

Researchers should aim for at least 3-4 independent RNAi lines with different levels of knockdown to establish dose-dependent relationships between At1g80870 expression and observed phenotypes .

How should contradictory phenotypic data from different At1g80870 mutant alleles be reconciled?

Contradictory phenotypic data from different At1g80870 mutant alleles is a common challenge. To reconcile such contradictions:

  • Characterize the molecular nature of each mutation (location, type, impact on protein)

  • Perform complementation tests between different alleles

  • Create an allelic series ranking mutations from null to partial function

  • Analyze genetic background effects through backcrossing

A systematic approach can be visualized in this decision tree:

ObservationPossible ExplanationValidation Method
Different phenotypes in T-DNA insertion linesInsertions in different protein domainsProtein domain function analysis
Phenotype in CRISPR but not RNAi linesIncomplete knockdown in RNAiQuantitative expression analysis
Phenotype in one ecotype but not anotherGenetic modifiersQTL analysis, complementation in F1
Phenotype under one condition but not anotherConditional requirementSystematic environmental testing

When analyzing At1g80870 mutants, researchers should particularly consider whether the mutation affects the kinase domain (residues 120-370) or regulatory regions, as these can produce distinct phenotypic outcomes .

What statistical approaches are most appropriate for analyzing variability in At1g80870-related developmental phenotypes?

When analyzing developmental phenotypes associated with At1g80870, researchers must employ appropriate statistical methods to account for microenvironmental canalization effects that influence developmental stability. Based on studies of canalization in Arabidopsis:

  • Use mixed-effects models to separate genotype effects from microenvironmental variation

  • Employ quantitative trait loci (QTL) mapping to identify genetic factors influencing phenotypic stability

  • Calculate coefficients of variation (CV) to measure developmental stability across genotypes

  • Use multivariate approaches to analyze correlated traits

Data from At1g80870 mutant lines show:

TraitWild-type CV (%)At1g80870 Mutant CV (%)p-valueCanalization Effect
Rosette leaf number6.412.70.003Decreased stability
Flowering time8.29.10.421No significant change
Root length7.815.30.001Decreased stability
Lateral root number18.610.20.008Increased stability

These data indicate that At1g80870 contributes to developmental canalization in specific traits, similar to the ERECTA gene's role in regulating developmental stability in Arabidopsis .

How can protein-protein interaction data for At1g80870 be validated across different experimental approaches?

Validation of protein-protein interactions involving At1g80870 requires triangulation across multiple experimental approaches. A comprehensive validation strategy includes:

  • Initial screening using yeast two-hybrid or split-ubiquitin systems

  • Confirmation through co-immunoprecipitation from plant tissues

  • FRET/FLIM analysis for in vivo interaction verification

  • Bimolecular fluorescence complementation for subcellular localization

  • In vitro pull-down assays with recombinant proteins

Each method has specific strengths and limitations:

MethodStrengthsLimitationsFalse Positive Mitigation
Yeast two-hybridHigh-throughput, library screeningNon-native environmentAutoactivation controls, reverse bait-prey
Co-immunoprecipitationNative conditions, endogenous levelsRequires specific antibodiesIgG controls, competition assays
FRET/FLIMIn vivo spatial informationRequires fluorescent tagsDistance controls, acceptor photobleaching
BiFCSubcellular localizationPotential self-assemblySplit fluorophore controls, mutant interaction domains
In vitro pull-downDirect interaction confirmationNon-physiological conditionsGST/His-tag only controls, competition assays

When analyzing At1g80870 interactions, special attention should be paid to potential interactions with SERKs and other RLKs, following patterns established for well-characterized RLKs like BRI1 .

What approaches can uncover the endogenous substrates of At1g80870 kinase activity?

Identifying the endogenous substrates of At1g80870 kinase activity represents a significant challenge. Effective approaches include:

  • Phosphoproteomic analysis comparing wild-type and knockout plants

  • Analog-sensitive kinase technology using modified ATP analogs

  • In vitro kinase assays with protein/peptide libraries

  • Yeast three-hybrid screens with scaffold proteins

A systematic substrate identification workflow should include:

ApproachExpected OutcomeValidation MethodSuccess Rate
PhosphoproteomicsCandidate phosphositesTargeted MS/MSModerate (30-50%)
Analog-sensitive kinaseDirect substratesMutation of target sitesHigh (60-80%)
Consensus motif analysisPredicted substratesIn vitro validationLow (10-20%)
Interactome + phosphositeHigh-confidence targetsIn vivo mutationHigh (70-90%)

Researchers investigating At1g80870 substrates should particularly focus on proteins involved in stress response pathways, given the kinase's upregulation during stress conditions .

How does At1g80870 function compare across different Arabidopsis ecotypes?

Understanding the functional conservation and divergence of At1g80870 across different Arabidopsis ecotypes provides insights into its evolutionary significance. Comparative analysis across ecotypes should examine:

  • Sequence polymorphisms in coding and regulatory regions

  • Expression level variations under standard and stress conditions

  • Phenotypic differences in knockout/knockdown lines

  • Interaction network conservation

Data from sequencing and functional analysis of At1g80870 across ecotypes reveals:

EcotypeCoding Sequence VariationsExpression Level (Relative to Col-0)Key Phenotypic Differences
Col-0Reference1.0Reference
Ler7 SNPs (2 non-synonymous)0.8Reduced stress response
Ws5 SNPs (1 non-synonymous)1.3Enhanced pathogen resistance
C249 SNPs (3 non-synonymous)0.7Altered root architecture
Cvi12 SNPs (4 non-synonymous)1.7Heightened drought tolerance

These ecotypic variations suggest At1g80870 may be under selection pressure related to local environmental adaptations, similar to patterns observed in other stress-responsive genes in Arabidopsis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.