Recombinant Arabidopsis thaliana Putative receptor-like protein kinase At2g30940 (At2g30940)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Putative Receptor-Like Protein Kinase At2g30940 (At2g30940)

Recombinant Arabidopsis thaliana Putative Receptor-Like Protein Kinase At2g30940 (At2g30940) is a protein kinase expressed in E. coli and tagged with N-terminal His for research purposes . At2g30940 is a member of the receptor-like kinase (RLK) family in Arabidopsis thaliana . RLKs are transmembrane proteins that play crucial roles in plant signaling pathways, enabling plants to perceive and respond to diverse environmental cues .

Gene Information and Protein Characteristics

The At2g30940 gene encodes a protein with 453 amino acids . The protein includes a kinase domain, which is essential for its enzymatic activity in phosphorylation .

Table 1: Key Features of At2g30940

FeatureDescription
Gene NameAt2g30940
SynonymsAt2g30940; F7F1.15; Putative receptor-like protein kinase At2g30940
UniProt IDQ3EBR4
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
Protein LengthFull Length (1-453 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Amino Acid SequenceMQEWLEILLIHTLIDSSSLSPQRLRVMNRIISSQGSDLIKQKLSQHTSFFGIKLWILITASASIAFLLVLIISVLLCFIFHRRRCSQEPFRLRSKLCLPLSHIPLTNKQQIPYNRCGDDIESQRISQVGWSSARLSYYTRSFSSTGSFGSFNVFTFMEIKNVTDSFADDNVITKGDSSTVYRGILMGTVTVAVKRFLPSNSRYEDKDFITKAEMIANVRHKNVVRLLGYCIEGDERVLVYEYAEKGDLHEWLHGSAGRNRPLTWRKRMKIIQGVAKGLAYIHEDIEPKITHQDIRPSKILLDYQWNPKILDVGFIGHSDIPTLIPSPGNMDEKIDVYSFGNMIMELVSGRVSVDQSSPHVRVYLVDWIKEMVANHMIVDVLDPSLPEFPTIKELKRIVLISLRCVDPELKERPKMGDVIHMLQPHDLLLNNNAIQKAQKITRSHEVSAISIRQ

Expression and Purification

The recombinant At2g30940 protein is produced in E. coli and includes an N-terminal His tag to facilitate purification using affinity chromatography . The purified protein typically appears as a lyophilized powder and should be stored at -20°C or -80°C to maintain stability . Researchers often reconstitute the protein in deionized sterile water, with the option of adding glycerol for long-term storage .

Function and Significance

At2g30940 is categorized as a putative receptor-like protein kinase, implying its potential role in signal transduction related to plant growth, development, and stress responses . RLKs like At2g30940 are involved in pattern-triggered immunity (PTI) and can mediate resistance to pathogens . Some RLKs interact with other receptor proteins, such as FLAGELLIN SENSING2 (FLS2), to enhance plant immunity .

Receptor-Like Kinases in Arabidopsis thaliana

Arabidopsis thaliana has a large family of receptor-like kinases, with over 50 subfamilies . These RLKs are key components in plant signaling, acting as signal transducers from the cell membrane to the nucleus . RLKs are involved in various processes, including hormone signaling, defense responses, and developmental regulation .

Research Applications

Recombinant At2g30940 can be employed in various biochemical assays, including kinase activity assays, protein-protein interaction studies, and structural analyses . Researchers use recombinant proteins to investigate the function and regulation of kinases in plant cells .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
At2g30940; F7F1.15; Putative receptor-like protein kinase At2g30940
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g30940
Target Protein Sequence
MQEWLEILLIHTLIDSSSLSPQRLRVMNRIISSQGSDLIKQKLSQHTSFFGIKLWILITA SASIAFLLVLIISVLLCFIFHRRRCSQEPFRLRSKLCLPLSHIPLTNKQQIPYNRCGDDI ESQRISQVGWSSARLSYYTRSFSSTGSFGSFNVFTFMEIKNVTDSFADDNVITKGDSSTV YRGILMGTVTVAVKRFLPSNSRYEDKDFITKAEMIANVRHKNVVRLLGYCIEGDERVLVY EYAEKGDLHEWLHGSAGRNRPLTWRKRMKIIQGVAKGLAYIHEDIEPKITHQDIRPSKIL LDYQWNPKILDVGFIGHSDIPTLIPSPGNMDEKIDVYSFGNMIMELVSGRVSVDQSSPHV RVYLVDWIKEMVANHMIVDVLDPSLPEFPTIKELKRIVLISLRCVDPELKERPKMGDVIH MLQPHDLLLNNNAIQKAQKITRSHEVSAISIRQ
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G30940

STRING: 3702.AT2G30940.2

UniGene: At.52984

Protein Families
Protein kinase superfamily
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is At2g30940 and what are its basic structural characteristics?

At2g30940 is a putative receptor-like protein kinase from Arabidopsis thaliana with a full length of 453 amino acids . As a putative receptor-like kinase, it likely contains an extracellular domain, a transmembrane region, and a cytoplasmic kinase domain, though detailed structural analysis is still developing. Recombinant versions of this protein have been successfully expressed in E. coli expression systems with histidine tags for purification purposes . The protein is encoded by a gene located on chromosome 2 of the Arabidopsis genome, as indicated by its systematic name (At2g30940, where "2" represents chromosome 2).

To study this protein structurally, researchers typically employ techniques such as:

  • X-ray crystallography or cryo-EM for 3D structure determination

  • Sequence alignment with known receptor-like kinases

  • Domain prediction using bioinformatics tools

  • Secondary structure analysis using circular dichroism

How is recombinant At2g30940 protein typically expressed and purified for research purposes?

Recombinant At2g30940 is typically expressed using E. coli as the host organism . The methodology for expression and purification generally follows these steps:

  • Gene cloning: The At2g30940 coding sequence is cloned into an expression vector, typically containing a histidine tag sequence for purification.

  • Transformation and expression: The construct is transformed into E. coli expression strains (commonly BL21(DE3) or derivatives).

  • Protein induction: Expression is induced using IPTG or similar inducers when bacterial cultures reach optimal density.

  • Cell lysis: Bacterial cells are harvested and lysed using methods such as sonication or French press.

  • Affinity purification: His-tagged At2g30940 is purified using nickel or cobalt affinity chromatography .

  • Secondary purification: Further purification may involve ion exchange chromatography or size exclusion chromatography to achieve higher purity.

  • Quality control: SDS-PAGE, Western blotting, and mass spectrometry are used to verify protein identity and purity.

For functional studies, researchers must carefully consider buffer conditions during purification to maintain the native conformation and activity of the kinase domain.

What experimental systems are available for studying At2g30940 function in Arabidopsis?

Several experimental systems are available for functional studies of At2g30940:

  • T-DNA insertion lines: Researchers can obtain Arabidopsis mutant lines with T-DNA insertions in At2g30940 from stock centers to study loss-of-function phenotypes .

  • Fluorescent marker systems: Similar to approaches used in recombination studies, researchers can develop fluorescent protein fusions with At2g30940 to track protein localization in planta .

  • Expression systems: Both heterologous (E. coli, yeast) and homologous (Arabidopsis protoplasts, cell cultures) expression systems can be employed for different aspects of functional characterization .

  • Transgenic overexpression: Creating At2g30940 overexpression lines under constitutive or inducible promoters can reveal gain-of-function phenotypes.

  • CRISPR/Cas9 genome editing: Precise mutations can be introduced to study specific domains or amino acid functions.

  • Meta-analysis of transcriptomic data: Public RNA-Seq datasets can be analyzed to understand At2g30940 expression patterns under various conditions .

For seed-based phenotypic assessment, methods similar to those developed for meiotic recombination studies can be adapted to track At2g30940-related phenotypes through generations .

How does At2g30940 respond to different abiotic stresses and what are the best experimental designs to measure these responses?

While specific At2g30940 stress responses are not directly detailed in the provided sources, researchers can design experiments based on established methodologies for studying stress-responsive kinases in Arabidopsis:

Experimental design for stress response assessment:

  • Transcriptional analysis:

    • Apply multiple stress treatments (ABA, salt, dehydration, osmotic, cold) to Arabidopsis seedlings or specific tissues

    • Extract RNA at different time points (0.5, 1, 3, 6, 12, 24 hours)

    • Perform RT-qPCR or RNA-Seq to measure At2g30940 expression changes

    • Calculate fold changes using metrics similar to the TN scores described for meta-analysis

  • Protein level and post-translational modification assessment:

    • Generate antibodies against At2g30940 or use epitope-tagged transgenic lines

    • Perform Western blot analysis after stress treatments

    • Use phospho-specific antibodies or mass spectrometry to detect stress-induced phosphorylation events

  • Genetic approach:

    • Compare wild-type, knockout, and overexpression lines under stress conditions

    • Measure physiological parameters (survival rate, chlorophyll content, ROS levels)

    • Document phenotypic differences using standardized stress assays

Meta-analysis approaches similar to those used for RNA-Seq data can help identify whether At2g30940 clusters with known ABA-dependent or ABA-independent stress response genes .

What are the challenges in resolving contradictory data about At2g30940 function, and how can these be addressed methodologically?

Researchers studying At2g30940 may encounter contradictory data due to several factors:

Common sources of contradictory data:

  • Ecotype differences: Different Arabidopsis ecotypes (Columbia, Landsberg erecta) may show variation in At2g30940 regulation or function .

  • Environmental conditions: Growth conditions such as temperature fluctuations can significantly impact experimental outcomes, as demonstrated in recombination studies .

  • Experimental approach differences: Different methods for assessing protein function may yield seemingly contradictory results.

  • Developmental stage variation: At2g30940 might function differently across tissues and developmental stages.

Methodological approaches to address contradictions:

  • Standardized experimental conditions:

    • Use controlled growth chambers rather than greenhouses to minimize temperature variations

    • Standardize light conditions, growth media composition, and other variables

  • Multi-method validation:

    • Apply multiple independent techniques to assess the same function

    • Combine in vitro biochemical assays with in vivo genetic studies

    • Use both loss-of-function and gain-of-function approaches

  • Statistical robustness:

    • Increase biological and technical replicates

    • Apply rigorous statistical analysis similar to meta-analysis approaches

    • Define clear significance thresholds (e.g., 2-fold, 5-fold, 10-fold changes)

  • Comprehensive genetic background control:

    • Include multiple ecotypes in studies

    • Control for potential T-DNA-induced rearrangements that might affect nearby genes

    • Generate complementation lines to confirm phenotype rescue

How can protein-protein interaction studies be optimized for At2g30940 to identify its signaling partners?

Identifying interaction partners is crucial for understanding At2g30940 function. Several methodological approaches can be optimized:

Optimized protein-protein interaction methodologies:

  • Yeast two-hybrid screening:

    • Use different domains of At2g30940 as baits (kinase domain, extracellular domain)

    • Screen against normalized Arabidopsis cDNA libraries

    • Validate interactions using confirmatory assays

    • Control for auto-activation with appropriate negative controls

  • Co-immunoprecipitation approaches:

    • Generate epitope-tagged At2g30940 constructs (His-tag, FLAG, HA)

    • Express in Arabidopsis protoplasts or stable transgenic lines

    • Optimize buffer conditions to preserve transient interactions

    • Identify partners using mass spectrometry

  • Bimolecular fluorescence complementation (BiFC):

    • Create fusion constructs of At2g30940 with split fluorescent protein fragments

    • Co-express with candidate interactors in Arabidopsis protoplasts

    • Visualize interactions using confocal microscopy

    • Quantify fluorescence to measure interaction strength

  • Proximity-dependent labeling:

    • Fuse At2g30940 with BioID or TurboID

    • Express in planta and provide biotin

    • Identify biotinylated proximal proteins by mass spectrometry

    • Map the spatial interactome around At2g30940

  • Phosphoproteomics:

    • Compare phosphoproteomes between wild-type and At2g30940 mutant plants

    • Identify differentially phosphorylated proteins as potential substrates

    • Validate with in vitro kinase assays using purified recombinant At2g30940

What are the best assays to measure the kinase activity of recombinant At2g30940 protein?

To determine whether At2g30940 possesses active kinase functionality, researchers can employ several complementary approaches:

Kinase activity assay methodologies:

  • In vitro phosphorylation assays:

    • Purify recombinant His-tagged At2g30940

    • Incubate with [γ-³²P]ATP or non-radioactive ATP

    • Detect autophosphorylation via autoradiography or phospho-specific antibodies

    • Test phosphorylation of generic substrates (myelin basic protein, histone H1)

  • Kinase-dead controls:

    • Generate point mutations in conserved ATP-binding residues or catalytic sites

    • Compare wild-type and mutant At2g30940 activity

    • Use as negative controls in all assays

  • Phosphoamino acid analysis:

    • Determine which amino acids are phosphorylated (Ser, Thr, Tyr)

    • Perform acid hydrolysis of phosphorylated proteins

    • Separate phosphoamino acids by thin-layer chromatography

  • In-gel kinase assays:

    • Separate proteins on SDS-PAGE containing substrate

    • Renature proteins and incubate with ATP

    • Detect phosphorylation activity at the molecular weight of At2g30940

  • Quantitative assays:

    • Use ADP-Glo™ or similar kits to measure ATP consumption

    • ELISA-based assays with phospho-specific antibodies

    • Fluorescence-based assays with phospho-sensing dyes

Assay TypeAdvantagesLimitationsRequired Controls
Radioactive assaysHigh sensitivity, direct measurementSafety concerns, specialized equipmentKinase-dead mutant, no-substrate control
Non-radioactive ATP consumptionSafer, quantitativeLess sensitive, indirectATP-only control, heat-inactivated enzyme
Phospho-antibody detectionSpecific phosphorylation sitesAntibody availabilityDephosphorylated samples, phosphatase treatment
In-gel kinase assaysActivity at native MW, multiple samplesLimited quantificationMolecular weight markers, known kinases

How can CRISPR/Cas9 genome editing be optimized for generating precise mutations in At2g30940?

CRISPR/Cas9 genome editing offers powerful approaches for functional studies of At2g30940. Here's a methodological workflow:

Optimized CRISPR/Cas9 editing methodology:

  • Guide RNA design:

    • Select target sites in critical domains (ATP-binding, catalytic loop, activation segment)

    • Use algorithms that maximize on-target efficiency and minimize off-target effects

    • Design multiple gRNAs targeting the same region to increase editing efficiency

    • Include PAM sites specific to the Cas9 variant being used

  • Construct assembly:

    • Clone gRNAs into Arabidopsis-optimized CRISPR/Cas9 vectors

    • Use promoters with appropriate expression patterns (constitutive or tissue-specific)

    • Consider egg cell-specific promoters for germline editing

  • Transformation and screening:

    • Transform Arabidopsis using floral dip method

    • Screen T1 plants using PCR and sequencing to identify mutations

    • Analyze multiple independent lines to control for off-target effects

    • Select homozygous mutants in T2 or T3 generations

  • Editing validation:

    • Confirm mutations by Sanger sequencing

    • Use next-generation sequencing for off-target analysis

    • Verify protein modification/absence by Western blot

  • Complementation:

    • Reintroduce wild-type At2g30940 to confirm phenotype rescue

    • Create site-directed variants to study specific amino acid functions

For precision editing (point mutations rather than knockouts), include a repair template with the desired mutation flanked by homology arms (~500-1000bp).

What are the most effective approaches for studying At2g30940 expression patterns in response to environmental stimuli?

Understanding At2g30940 expression patterns requires multi-level analysis approaches:

Expression analysis methodology:

  • Transcriptional profiling:

    • Perform RT-qPCR analysis following different treatments

    • Design gene-specific primers spanning exon-exon junctions

    • Normalize to multiple reference genes stable under stress conditions

    • Apply RNA-Seq for genome-wide context and alternative splicing detection

  • Promoter analysis:

    • Clone the At2g30940 promoter (1-2kb upstream region)

    • Fuse to reporter genes (GUS, LUC, fluorescent proteins)

    • Generate stable transgenic Arabidopsis lines

    • Analyze promoter activity under different treatments

  • In situ hybridization:

    • Design RNA probes specific to At2g30940

    • Perform in situ hybridization on tissue sections

    • Visualize tissue and cell-specific expression patterns

  • Meta-analysis approaches:

    • Utilize public transcriptomic datasets

    • Calculate differential expression metrics (e.g., TN scores)

    • Cluster At2g30940 with genes of known function

    • Identify conditions that strongly regulate expression

  • Live-cell imaging:

    • Create translational fusions with fluorescent proteins

    • Monitor protein levels and localization changes in real-time

    • Quantify fluorescence intensity under different treatments

Similar to approaches used in stress-responsive gene identification, researchers can apply multiple stress treatments (ABA, salt, dehydration, osmotic, cold) and compare At2g30940 expression changes across conditions .

How can researchers determine if At2g30940 functions in ABA-dependent or ABA-independent stress response pathways?

Distinguishing between ABA-dependent and ABA-independent function requires strategic experimental design:

Methodological approach:

  • Comparative expression analysis:

    • Treat wild-type plants with ABA and various stresses (salt, dehydration, osmotic, cold)

    • Measure At2g30940 expression changes using RT-qPCR or RNA-Seq

    • Compare expression patterns across treatments

    • Determine if At2g30940 clusters with known ABA-dependent or ABA-independent genes

  • Genetic analysis:

    • Cross At2g30940 mutants with ABA-insensitive mutants (abi1, abi2, abi3)

    • Analyze epistatic relationships

    • Test At2g30940 expression in ABA biosynthesis mutants (aba1, aba2)

    • Determine if ABA application rescues At2g30940 mutant phenotypes

  • Promoter analysis:

    • Identify ABA-responsive elements (ABREs) in the At2g30940 promoter

    • Perform chromatin immunoprecipitation with transcription factors known to bind ABREs

    • Create promoter-reporter constructs with mutated ABRE sites

    • Test promoter activity with and without ABA treatment

  • Physiological responses:

    • Compare stomatal responses in wild-type and At2g30940 mutants

    • Measure ABA content in At2g30940 overexpression lines

    • Analyze seed germination sensitivity to ABA in mutant lines

The meta-analysis approach for ABA-related stress conditions can be particularly valuable for positioning At2g30940 within known stress response networks .

What techniques can be used to identify the subcellular localization of At2g30940 and how does this inform its function?

Determining subcellular localization is crucial for understanding receptor-like kinase function:

Localization methodologies:

  • Fluorescent protein fusions:

    • Create N- and C-terminal GFP/RFP fusions of At2g30940

    • Express in Arabidopsis protoplasts, seedlings, or stable transgenic lines

    • Visualize using confocal microscopy

    • Co-localize with organelle-specific markers

    • Use techniques similar to those developed for fluorescent markers in recombination studies

  • Immunolocalization:

    • Generate antibodies against At2g30940

    • Perform immunofluorescence on fixed Arabidopsis tissues

    • Co-label with organelle markers

    • Use super-resolution microscopy for detailed localization

  • Biochemical fractionation:

    • Isolate cellular fractions (plasma membrane, ER, Golgi, etc.)

    • Detect At2g30940 by Western blotting

    • Compare distribution across fractions

  • Topology analysis:

    • Use protease protection assays to determine membrane orientation

    • Apply glycosylation mapping for lumenal domains

    • Employ self-associating fluorescent protein tags to confirm topology

  • Dynamic relocalization studies:

    • Monitor potential changes in localization following stress treatments

    • Use photoactivatable or photoconvertible fluorescent proteins to track movement

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

ApproachResolutionLive/FixedAdvantagesLimitations
GFP fusionSubcellularLiveReal-time visualization, dynamic studiesPotential fusion artifacts
ImmunofluorescenceSubcellularFixedEndogenous protein detectionAntibody specificity, fixation artifacts
Biochemical fractionationOrganelle-levelFixedQuantitative, biochemical confirmationLow spatial resolution, contamination issues
Electron microscopySub-organelleFixedHighest resolutionComplex sample preparation, no live imaging

What are the most robust phenotyping approaches to determine the physiological impact of At2g30940 mutations?

Robust phenotyping requires multi-parameter assessment across development and stress conditions:

Comprehensive phenotyping methodology:

  • Growth and development:

    • Measure primary root length, lateral root number, and root hair density

    • Document leaf area, rosette diameter, and flowering time

    • Quantify seed yield, silique length, and seed size

    • Analyze stem height and branching patterns

    • Use automated phenotyping platforms for high-throughput measurements

  • Stress tolerance phenotyping:

    • Assess germination rates under osmotic stress (mannitol, PEG)

    • Measure electrolyte leakage following freezing or heat stress

    • Quantify water loss rates in detached leaves

    • Evaluate survival rates under drought, salt, and temperature extremes

    • Measure ABA sensitivity in seed germination and root growth assays

  • Cellular and biochemical phenotyping:

    • Analyze stomatal density and aperture responses

    • Measure reactive oxygen species levels using fluorescent dyes

    • Quantify stress hormone levels (ABA, ethylene, jasmonic acid)

    • Determine osmolyte accumulation (proline, sugars)

    • Assess photosynthetic parameters using chlorophyll fluorescence

  • Seed-based assays:

    • Adapt fluorescent marker approaches from recombination studies to track At2g30940-related phenotypes

    • Evaluate seed storage protein accumulation

    • Measure germination timing and uniformity

  • Multi-generation analysis:

    • Assess trait stability across generations

    • Evaluate reproductive fitness under stress conditions

    • Compare competitive ability in mixed populations

For statistical robustness, all phenotyping should include appropriate controls and sufficient biological replication, with controlled growth conditions to minimize environmental variations that could mask genetic effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.