Recombinant Arabidopsis thaliana Putative Receptor-Like Protein Kinase At2g30940 (At2g30940) is a protein kinase expressed in E. coli and tagged with N-terminal His for research purposes . At2g30940 is a member of the receptor-like kinase (RLK) family in Arabidopsis thaliana . RLKs are transmembrane proteins that play crucial roles in plant signaling pathways, enabling plants to perceive and respond to diverse environmental cues .
The At2g30940 gene encodes a protein with 453 amino acids . The protein includes a kinase domain, which is essential for its enzymatic activity in phosphorylation .
| Feature | Description |
|---|---|
| Gene Name | At2g30940 |
| Synonyms | At2g30940; F7F1.15; Putative receptor-like protein kinase At2g30940 |
| UniProt ID | Q3EBR4 |
| Species | Arabidopsis thaliana |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-453 amino acids) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Amino Acid Sequence | MQEWLEILLIHTLIDSSSLSPQRLRVMNRIISSQGSDLIKQKLSQHTSFFGIKLWILITASASIAFLLVLIISVLLCFIFHRRRCSQEPFRLRSKLCLPLSHIPLTNKQQIPYNRCGDDIESQRISQVGWSSARLSYYTRSFSSTGSFGSFNVFTFMEIKNVTDSFADDNVITKGDSSTVYRGILMGTVTVAVKRFLPSNSRYEDKDFITKAEMIANVRHKNVVRLLGYCIEGDERVLVYEYAEKGDLHEWLHGSAGRNRPLTWRKRMKIIQGVAKGLAYIHEDIEPKITHQDIRPSKILLDYQWNPKILDVGFIGHSDIPTLIPSPGNMDEKIDVYSFGNMIMELVSGRVSVDQSSPHVRVYLVDWIKEMVANHMIVDVLDPSLPEFPTIKELKRIVLISLRCVDPELKERPKMGDVIHMLQPHDLLLNNNAIQKAQKITRSHEVSAISIRQ |
The recombinant At2g30940 protein is produced in E. coli and includes an N-terminal His tag to facilitate purification using affinity chromatography . The purified protein typically appears as a lyophilized powder and should be stored at -20°C or -80°C to maintain stability . Researchers often reconstitute the protein in deionized sterile water, with the option of adding glycerol for long-term storage .
At2g30940 is categorized as a putative receptor-like protein kinase, implying its potential role in signal transduction related to plant growth, development, and stress responses . RLKs like At2g30940 are involved in pattern-triggered immunity (PTI) and can mediate resistance to pathogens . Some RLKs interact with other receptor proteins, such as FLAGELLIN SENSING2 (FLS2), to enhance plant immunity .
Arabidopsis thaliana has a large family of receptor-like kinases, with over 50 subfamilies . These RLKs are key components in plant signaling, acting as signal transducers from the cell membrane to the nucleus . RLKs are involved in various processes, including hormone signaling, defense responses, and developmental regulation .
Recombinant At2g30940 can be employed in various biochemical assays, including kinase activity assays, protein-protein interaction studies, and structural analyses . Researchers use recombinant proteins to investigate the function and regulation of kinases in plant cells .
At2g30940 is a putative receptor-like protein kinase from Arabidopsis thaliana with a full length of 453 amino acids . As a putative receptor-like kinase, it likely contains an extracellular domain, a transmembrane region, and a cytoplasmic kinase domain, though detailed structural analysis is still developing. Recombinant versions of this protein have been successfully expressed in E. coli expression systems with histidine tags for purification purposes . The protein is encoded by a gene located on chromosome 2 of the Arabidopsis genome, as indicated by its systematic name (At2g30940, where "2" represents chromosome 2).
To study this protein structurally, researchers typically employ techniques such as:
X-ray crystallography or cryo-EM for 3D structure determination
Sequence alignment with known receptor-like kinases
Domain prediction using bioinformatics tools
Secondary structure analysis using circular dichroism
Recombinant At2g30940 is typically expressed using E. coli as the host organism . The methodology for expression and purification generally follows these steps:
Gene cloning: The At2g30940 coding sequence is cloned into an expression vector, typically containing a histidine tag sequence for purification.
Transformation and expression: The construct is transformed into E. coli expression strains (commonly BL21(DE3) or derivatives).
Protein induction: Expression is induced using IPTG or similar inducers when bacterial cultures reach optimal density.
Cell lysis: Bacterial cells are harvested and lysed using methods such as sonication or French press.
Affinity purification: His-tagged At2g30940 is purified using nickel or cobalt affinity chromatography .
Secondary purification: Further purification may involve ion exchange chromatography or size exclusion chromatography to achieve higher purity.
Quality control: SDS-PAGE, Western blotting, and mass spectrometry are used to verify protein identity and purity.
For functional studies, researchers must carefully consider buffer conditions during purification to maintain the native conformation and activity of the kinase domain.
Several experimental systems are available for functional studies of At2g30940:
T-DNA insertion lines: Researchers can obtain Arabidopsis mutant lines with T-DNA insertions in At2g30940 from stock centers to study loss-of-function phenotypes .
Fluorescent marker systems: Similar to approaches used in recombination studies, researchers can develop fluorescent protein fusions with At2g30940 to track protein localization in planta .
Expression systems: Both heterologous (E. coli, yeast) and homologous (Arabidopsis protoplasts, cell cultures) expression systems can be employed for different aspects of functional characterization .
Transgenic overexpression: Creating At2g30940 overexpression lines under constitutive or inducible promoters can reveal gain-of-function phenotypes.
CRISPR/Cas9 genome editing: Precise mutations can be introduced to study specific domains or amino acid functions.
Meta-analysis of transcriptomic data: Public RNA-Seq datasets can be analyzed to understand At2g30940 expression patterns under various conditions .
For seed-based phenotypic assessment, methods similar to those developed for meiotic recombination studies can be adapted to track At2g30940-related phenotypes through generations .
While specific At2g30940 stress responses are not directly detailed in the provided sources, researchers can design experiments based on established methodologies for studying stress-responsive kinases in Arabidopsis:
Experimental design for stress response assessment:
Transcriptional analysis:
Apply multiple stress treatments (ABA, salt, dehydration, osmotic, cold) to Arabidopsis seedlings or specific tissues
Extract RNA at different time points (0.5, 1, 3, 6, 12, 24 hours)
Perform RT-qPCR or RNA-Seq to measure At2g30940 expression changes
Calculate fold changes using metrics similar to the TN scores described for meta-analysis
Protein level and post-translational modification assessment:
Generate antibodies against At2g30940 or use epitope-tagged transgenic lines
Perform Western blot analysis after stress treatments
Use phospho-specific antibodies or mass spectrometry to detect stress-induced phosphorylation events
Genetic approach:
Compare wild-type, knockout, and overexpression lines under stress conditions
Measure physiological parameters (survival rate, chlorophyll content, ROS levels)
Document phenotypic differences using standardized stress assays
Meta-analysis approaches similar to those used for RNA-Seq data can help identify whether At2g30940 clusters with known ABA-dependent or ABA-independent stress response genes .
Researchers studying At2g30940 may encounter contradictory data due to several factors:
Common sources of contradictory data:
Ecotype differences: Different Arabidopsis ecotypes (Columbia, Landsberg erecta) may show variation in At2g30940 regulation or function .
Environmental conditions: Growth conditions such as temperature fluctuations can significantly impact experimental outcomes, as demonstrated in recombination studies .
Experimental approach differences: Different methods for assessing protein function may yield seemingly contradictory results.
Developmental stage variation: At2g30940 might function differently across tissues and developmental stages.
Methodological approaches to address contradictions:
Standardized experimental conditions:
Multi-method validation:
Apply multiple independent techniques to assess the same function
Combine in vitro biochemical assays with in vivo genetic studies
Use both loss-of-function and gain-of-function approaches
Statistical robustness:
Comprehensive genetic background control:
Identifying interaction partners is crucial for understanding At2g30940 function. Several methodological approaches can be optimized:
Optimized protein-protein interaction methodologies:
Yeast two-hybrid screening:
Use different domains of At2g30940 as baits (kinase domain, extracellular domain)
Screen against normalized Arabidopsis cDNA libraries
Validate interactions using confirmatory assays
Control for auto-activation with appropriate negative controls
Co-immunoprecipitation approaches:
Generate epitope-tagged At2g30940 constructs (His-tag, FLAG, HA)
Express in Arabidopsis protoplasts or stable transgenic lines
Optimize buffer conditions to preserve transient interactions
Identify partners using mass spectrometry
Bimolecular fluorescence complementation (BiFC):
Create fusion constructs of At2g30940 with split fluorescent protein fragments
Co-express with candidate interactors in Arabidopsis protoplasts
Visualize interactions using confocal microscopy
Quantify fluorescence to measure interaction strength
Proximity-dependent labeling:
Fuse At2g30940 with BioID or TurboID
Express in planta and provide biotin
Identify biotinylated proximal proteins by mass spectrometry
Map the spatial interactome around At2g30940
Phosphoproteomics:
To determine whether At2g30940 possesses active kinase functionality, researchers can employ several complementary approaches:
Kinase activity assay methodologies:
In vitro phosphorylation assays:
Kinase-dead controls:
Generate point mutations in conserved ATP-binding residues or catalytic sites
Compare wild-type and mutant At2g30940 activity
Use as negative controls in all assays
Phosphoamino acid analysis:
Determine which amino acids are phosphorylated (Ser, Thr, Tyr)
Perform acid hydrolysis of phosphorylated proteins
Separate phosphoamino acids by thin-layer chromatography
In-gel kinase assays:
Separate proteins on SDS-PAGE containing substrate
Renature proteins and incubate with ATP
Detect phosphorylation activity at the molecular weight of At2g30940
Quantitative assays:
Use ADP-Glo™ or similar kits to measure ATP consumption
ELISA-based assays with phospho-specific antibodies
Fluorescence-based assays with phospho-sensing dyes
| Assay Type | Advantages | Limitations | Required Controls |
|---|---|---|---|
| Radioactive assays | High sensitivity, direct measurement | Safety concerns, specialized equipment | Kinase-dead mutant, no-substrate control |
| Non-radioactive ATP consumption | Safer, quantitative | Less sensitive, indirect | ATP-only control, heat-inactivated enzyme |
| Phospho-antibody detection | Specific phosphorylation sites | Antibody availability | Dephosphorylated samples, phosphatase treatment |
| In-gel kinase assays | Activity at native MW, multiple samples | Limited quantification | Molecular weight markers, known kinases |
CRISPR/Cas9 genome editing offers powerful approaches for functional studies of At2g30940. Here's a methodological workflow:
Optimized CRISPR/Cas9 editing methodology:
Guide RNA design:
Select target sites in critical domains (ATP-binding, catalytic loop, activation segment)
Use algorithms that maximize on-target efficiency and minimize off-target effects
Design multiple gRNAs targeting the same region to increase editing efficiency
Include PAM sites specific to the Cas9 variant being used
Construct assembly:
Clone gRNAs into Arabidopsis-optimized CRISPR/Cas9 vectors
Use promoters with appropriate expression patterns (constitutive or tissue-specific)
Consider egg cell-specific promoters for germline editing
Transformation and screening:
Transform Arabidopsis using floral dip method
Screen T1 plants using PCR and sequencing to identify mutations
Analyze multiple independent lines to control for off-target effects
Select homozygous mutants in T2 or T3 generations
Editing validation:
Confirm mutations by Sanger sequencing
Use next-generation sequencing for off-target analysis
Verify protein modification/absence by Western blot
Complementation:
Reintroduce wild-type At2g30940 to confirm phenotype rescue
Create site-directed variants to study specific amino acid functions
For precision editing (point mutations rather than knockouts), include a repair template with the desired mutation flanked by homology arms (~500-1000bp).
Understanding At2g30940 expression patterns requires multi-level analysis approaches:
Expression analysis methodology:
Transcriptional profiling:
Promoter analysis:
Clone the At2g30940 promoter (1-2kb upstream region)
Fuse to reporter genes (GUS, LUC, fluorescent proteins)
Generate stable transgenic Arabidopsis lines
Analyze promoter activity under different treatments
In situ hybridization:
Design RNA probes specific to At2g30940
Perform in situ hybridization on tissue sections
Visualize tissue and cell-specific expression patterns
Meta-analysis approaches:
Live-cell imaging:
Create translational fusions with fluorescent proteins
Monitor protein levels and localization changes in real-time
Quantify fluorescence intensity under different treatments
Similar to approaches used in stress-responsive gene identification, researchers can apply multiple stress treatments (ABA, salt, dehydration, osmotic, cold) and compare At2g30940 expression changes across conditions .
Distinguishing between ABA-dependent and ABA-independent function requires strategic experimental design:
Methodological approach:
Comparative expression analysis:
Genetic analysis:
Cross At2g30940 mutants with ABA-insensitive mutants (abi1, abi2, abi3)
Analyze epistatic relationships
Test At2g30940 expression in ABA biosynthesis mutants (aba1, aba2)
Determine if ABA application rescues At2g30940 mutant phenotypes
Promoter analysis:
Identify ABA-responsive elements (ABREs) in the At2g30940 promoter
Perform chromatin immunoprecipitation with transcription factors known to bind ABREs
Create promoter-reporter constructs with mutated ABRE sites
Test promoter activity with and without ABA treatment
Physiological responses:
Compare stomatal responses in wild-type and At2g30940 mutants
Measure ABA content in At2g30940 overexpression lines
Analyze seed germination sensitivity to ABA in mutant lines
The meta-analysis approach for ABA-related stress conditions can be particularly valuable for positioning At2g30940 within known stress response networks .
Determining subcellular localization is crucial for understanding receptor-like kinase function:
Localization methodologies:
Fluorescent protein fusions:
Immunolocalization:
Generate antibodies against At2g30940
Perform immunofluorescence on fixed Arabidopsis tissues
Co-label with organelle markers
Use super-resolution microscopy for detailed localization
Biochemical fractionation:
Isolate cellular fractions (plasma membrane, ER, Golgi, etc.)
Detect At2g30940 by Western blotting
Compare distribution across fractions
Topology analysis:
Use protease protection assays to determine membrane orientation
Apply glycosylation mapping for lumenal domains
Employ self-associating fluorescent protein tags to confirm topology
Dynamic relocalization studies:
Monitor potential changes in localization following stress treatments
Use photoactivatable or photoconvertible fluorescent proteins to track movement
Perform FRAP (Fluorescence Recovery After Photobleaching) to assess mobility
| Approach | Resolution | Live/Fixed | Advantages | Limitations |
|---|---|---|---|---|
| GFP fusion | Subcellular | Live | Real-time visualization, dynamic studies | Potential fusion artifacts |
| Immunofluorescence | Subcellular | Fixed | Endogenous protein detection | Antibody specificity, fixation artifacts |
| Biochemical fractionation | Organelle-level | Fixed | Quantitative, biochemical confirmation | Low spatial resolution, contamination issues |
| Electron microscopy | Sub-organelle | Fixed | Highest resolution | Complex sample preparation, no live imaging |
Robust phenotyping requires multi-parameter assessment across development and stress conditions:
Comprehensive phenotyping methodology:
Growth and development:
Measure primary root length, lateral root number, and root hair density
Document leaf area, rosette diameter, and flowering time
Quantify seed yield, silique length, and seed size
Analyze stem height and branching patterns
Use automated phenotyping platforms for high-throughput measurements
Stress tolerance phenotyping:
Assess germination rates under osmotic stress (mannitol, PEG)
Measure electrolyte leakage following freezing or heat stress
Quantify water loss rates in detached leaves
Evaluate survival rates under drought, salt, and temperature extremes
Measure ABA sensitivity in seed germination and root growth assays
Cellular and biochemical phenotyping:
Analyze stomatal density and aperture responses
Measure reactive oxygen species levels using fluorescent dyes
Quantify stress hormone levels (ABA, ethylene, jasmonic acid)
Determine osmolyte accumulation (proline, sugars)
Assess photosynthetic parameters using chlorophyll fluorescence
Seed-based assays:
Multi-generation analysis:
Assess trait stability across generations
Evaluate reproductive fitness under stress conditions
Compare competitive ability in mixed populations
For statistical robustness, all phenotyping should include appropriate controls and sufficient biological replication, with controlled growth conditions to minimize environmental variations that could mask genetic effects .