Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL12 (ATL12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted to your needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
ATL12; At2g20030; T2G17.17; Putative RING-H2 finger protein ATL12; RING-type E3 ubiquitin transferase ATL12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-390
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL12
Target Protein Sequence
QSPPPPNLYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAKCFHNDLRSETDSDGERIRH DRLWQGLFNRSSRFSGLDKKAIESLPFFRFSALKGLKQGLECSVCLSKFEDVEILRLLPK CRHAFHIGCIDQWLEQHATCPLCRNRVNIEDDLSVLGNSSTSLRILNQSETREEDSRLEI YIEREEGTNDGSSRFSSFRKILKKSLLLEREGNENIDEKKLMHKFNHRIVVSDAVFKNRW SNITSSDLTFLTSEMLNSVSSDRFSSVDRVHRGNLRDKEDMEMKRMLIKHKDSSRRTVSE ITTVSREKAVGGSYRGSTASTSQNYAVTATTEERRRRLWLPIARRTAQWFVNREKSNDLN TTRQNLNV
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of ATL12 protein?

ATL12 (Arabidopsis Toxicos en Levadura 12) is a plasma membrane-localized protein that contains RING domains and transmembrane domains. The full-length mature protein spans amino acids 23-390 and functions as a RING-type E3 ubiquitin transferase. Subcellular co-localization studies using ATL12-GFP fusion protein with plasma membrane-mcherry markers confirm its plasma membrane localization . The protein belongs to the ATL2 family, which contains both RING domains and transmembrane domains, with some members containing PEST domains associated with proteins having short half-lives within cells .

What is the expression pattern of ATL12 in Arabidopsis tissues?

Histochemical staining utilizing the pATL12-GUS reporter construct has demonstrated that ATL12 is continuously expressed throughout the plant, including roots, leaves, stems, and flowers. This widespread expression pattern suggests its fundamental role in multiple plant tissues rather than tissue-specific functions . The constitutive expression across various plant organs provides insight into ATL12's potential role in general plant defense mechanisms rather than tissue-specific responses.

How does ATL12 respond to fungal infection in Arabidopsis?

ATL12 expression is highly induced in response to fungal infection. Loss-of-function mutations in the atl12 gene lead to increased susceptibility to the powdery mildew pathogen Golovinomyces cichoracearum. Conversely, overexpression of ATL12 in Arabidopsis significantly enhances resistance to mildew infection . The protein's rapid induction following fungal challenge indicates its role as an early response factor in plant immunity, potentially serving as a valuable marker for monitoring plant defense activation.

What protocol is recommended for reconstitution of recombinant ATL12 protein?

For optimal reconstitution of lyophilized recombinant ATL12 protein:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they compromise protein stability

How does ATL12 integrate into the chitin-triggered immune signaling pathway?

ATL12 is highly induced by chitin treatment within two hours, indicating its early role in chitin-triggered immunity. Experimental evidence suggests ATL12 functions downstream of MAPK cascades in the chitin response pathway. Analysis using RT-PCR demonstrates reduced expression of respiratory burst oxidase homolog proteins D and F (AtRBOHD/F) in atl12 mutants, while ATL12 expression remains unaffected in atrbohd and atrbohf mutants .

This unidirectional relationship indicates that:

  • ATL12 acts upstream of AtRBOHD/F in the signaling pathway

  • Chitin perception leads to MAPK activation, which induces ATL12 expression

  • ATL12 subsequently regulates NADPH oxidase activity through AtRBOHD/F

  • This cascade ultimately results in ROS production essential for antimicrobial defense

The methodological approach to verify these relationships would involve:

  • Chitin treatment time-course experiments with MAPK inhibitors

  • Proteomic analysis of protein-protein interactions between ATL12 and MAPK pathway components

  • Measurement of ROS production in various genetic backgrounds (wild-type, atl12, atrbohd/f mutants)

What methodologies effectively assess the role of ATL12 in reactive oxygen species (ROS) production?

To investigate ATL12's role in ROS production:

  • Histochemical Analysis: 3,3′-diaminobenzidine (DAB) staining should be performed on atl12 mutants compared to wild-type Col-0 plants following pathogen challenge or elicitor treatment. This visual approach reveals that atl12 mutants generate significantly less ROS compared to wild-type plants .

  • Genetic Complementation Assays: Express ATL12 in atl12 mutant backgrounds under native or inducible promoters and measure restoration of ROS production.

  • Gene Expression Analysis: Use RT-PCR to quantify expression levels of NADPH oxidase genes (particularly AtRBOHD/F) in various genetic backgrounds and treatment conditions. The expression of these genes is notably decreased in atl12 mutants .

  • Enzyme Activity Assays: Measure NADPH oxidase activity directly in membrane fractions isolated from wild-type and mutant plants.

  • Pharmacological Approach: Apply NADPH oxidase inhibitors (e.g., diphenyleneiodonium) to ATL12-overexpressing lines to determine if ROS production is suppressed.

How does ATL12 mediate crosstalk between salicylic acid and jasmonic acid signaling pathways?

ATL12 expression is upregulated following treatment with both salicylic acid (SA) and jasmonic acid (JA), suggesting its involvement in coordinating responses between these two typically antagonistic hormonal pathways . To experimentally investigate this crosstalk function:

  • Hormone Treatment Time-Course: Apply SA and JA both individually and in combination, followed by quantification of ATL12 expression at multiple time points using RT-qPCR.

  • Genetic Approach: Analyze ATL12 expression in SA-deficient (e.g., sid2) and JA-deficient (e.g., aos) mutant backgrounds to determine pathway dependency.

  • Transcriptome Analysis: Compare genome-wide expression patterns between wild-type and atl12 mutants following hormone treatments to identify SA- and JA-responsive genes regulated by ATL12.

  • ChIP-seq Analysis: Identify transcription factors that bind to the ATL12 promoter following hormone treatments to elucidate upstream regulatory mechanisms.

  • Protein-Protein Interaction Studies: Investigate whether ATL12 physically interacts with components of SA or JA signaling pathways using co-immunoprecipitation or yeast two-hybrid assays.

What experimental approaches can be used to investigate ATL12's E3 ubiquitin ligase activity and its targets?

As a RING-type E3 ubiquitin transferase , ATL12 likely regulates protein degradation through the ubiquitin-proteasome system. To identify and validate its targets:

  • In Vitro Ubiquitination Assays:

    • Express and purify recombinant His-tagged ATL12 protein from E. coli

    • Combine with E1, E2, ubiquitin, ATP, and potential substrate proteins

    • Detect ubiquitination activity using anti-ubiquitin antibodies

  • Proximity-Dependent Biotin Identification (BioID):

    • Generate ATL12-BioID fusion constructs for expression in Arabidopsis

    • Identify biotinylated proteins that physically interact with ATL12

    • Validate interactions using co-immunoprecipitation

  • Proteomics Approach:

    • Compare protein abundance profiles between wild-type and atl12 mutants

    • Identify proteins that accumulate in the absence of ATL12

    • Confirm direct ubiquitination using immunoprecipitation with anti-ubiquitin antibodies

  • Yeast Two-Hybrid Screening:

    • Use ATL12 as bait to screen an Arabidopsis cDNA library

    • Validate interactions in planta using BiFC (Bimolecular Fluorescence Complementation)

What expression systems are optimal for producing functional recombinant ATL12 protein?

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, potential inclusion body formationIn vitro biochemical assays, antibody production
Insect cellsBetter protein folding, some post-translational modificationsHigher cost, longer production timeFunctional studies requiring proper protein folding
Plant expression systemsNative post-translational modifications, proper membrane localizationLower yield, more complex protocolsIn vivo functional studies, complementation assays

For membrane proteins like ATL12, consider:

  • Adding solubilizing tags (MBP, SUMO)

  • Optimizing growth temperature (typically lowering to 16-20°C)

  • Including appropriate detergents during purification

  • Using specialized E. coli strains (e.g., Rosetta for rare codons, SHuffle for disulfide bond formation)

How can researchers effectively study ATL12's role in plant defense signaling networks?

A comprehensive experimental framework for investigating ATL12's role in defense signaling should include:

  • Genetic Resources Development:

    • Generate multiple independent atl12 knockout/knockdown lines using T-DNA insertion or CRISPR-Cas9

    • Create ATL12 overexpression lines under constitutive and inducible promoters

    • Develop point mutations in functional domains (RING finger, transmembrane domain)

  • Transcriptomic Analysis:

    • Perform RNA-seq comparing wild-type and atl12 mutants under:

      • Basal conditions

      • Fungal infection (e.g., Golovinomyces cichoracearum)

      • Chitin treatment

      • Hormone treatments (SA, JA)

    • Identify defense-related genes regulated by ATL12

  • Protein-Protein Interaction Network:

    • Immunoprecipitate ATL12 followed by mass spectrometry to identify interactors

    • Validate interactions using BiFC, FRET, or split-luciferase assays

    • Map interaction domains through deletion and point mutations

  • Physiological Assays:

    • Quantify resistance to multiple pathogens (biotrophic and necrotrophic)

    • Measure ROS production using luminol-based assays and DAB staining

    • Assess callose deposition and other defense responses

What strategies can resolve contradictory findings about ATL12 function in different experimental systems?

When facing contradictory results about ATL12 function across different studies or experimental systems, implement these methodological approaches:

  • Standardize Genetic Materials:

    • Use multiple independently generated mutant lines

    • Ensure proper genetic background control (backcrossing)

    • Verify mutation/transgene by sequencing and expression analysis

  • Control Environmental Variables:

    • Standardize growth conditions (light, temperature, humidity)

    • Use age-matched plants for experiments

    • Document soil composition, growth media, and watering regimes

  • Apply Multiple Complementary Techniques:

    • Combine genetic, biochemical, and cell biological approaches

    • Use both in vitro and in vivo systems to validate findings

    • Employ dose-response experiments rather than single concentrations

  • Data Integration Approach:

    • Conduct meta-analysis of available datasets

    • Develop mathematical models to predict ATL12 behavior under various conditions

    • Validate model predictions with targeted experiments

  • Collaboration Strategy:

    • Establish collaboration between labs reporting contradictory results

    • Exchange materials and protocols

    • Perform side-by-side experiments with standardized conditions

How might genomic editing technologies enhance our understanding of ATL12 function?

CRISPR-Cas9 and related technologies offer powerful approaches to study ATL12 function beyond traditional knockout studies:

  • Domain-Specific Mutagenesis:

    • Target specific functional domains (RING finger, transmembrane domain)

    • Create point mutations that affect activity rather than protein stability

    • Generate allelic series to identify separation-of-function mutations

  • Promoter Engineering:

    • Modify ATL12 promoter elements to disrupt specific transcription factor binding sites

    • Identify essential cis-regulatory elements for pathogen and hormone responsiveness

    • Create synthetic promoters with enhanced or altered responsiveness

  • Protein Tagging at Endogenous Locus:

    • Add fluorescent or epitope tags to endogenous ATL12 without overexpression

    • Create conditional degradation systems (e.g., auxin-inducible degron)

    • Implement proximity labeling systems at the genomic locus

  • Multiplexed Editing:

    • Simultaneously target ATL12 and related family members to address functional redundancy

    • Create higher-order mutants in ATL12-regulated pathways

    • Modify multiple elements in defense signaling networks to assess genetic interactions

What are the implications of ATL12's role in hormone crosstalk for developing disease-resistant crops?

ATL12's involvement in both SA and JA signaling pathways presents unique opportunities for crop improvement:

  • Targeted Breeding Strategies:

    • Identify natural variants of ATL12 in crop species with enhanced defense capability

    • Screen germplasm collections for optimal ATL12 alleles

    • Develop molecular markers for ATL12 for marker-assisted breeding

  • Transgenic Approaches:

    • Express modified ATL12 variants with enhanced stability or activity

    • Use synthetic promoters to optimize expression patterns

    • Fine-tune ATL12 expression to balance growth and defense trade-offs

  • Induced Resistance Applications:

    • Develop chemical compounds that activate ATL12-dependent pathways

    • Identify natural elicitors that specifically induce ATL12 expression

    • Create priming treatments that enhance ATL12 responsiveness

  • Predictive Modeling:

    • Develop computational models of ATL12-mediated defense networks

    • Predict crop responses to pathogen challenges based on ATL12 status

    • Simulate effects of environmental variables on ATL12-dependent defenses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.