Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL19 (ATL19)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please specify it in your order.
Synonyms
ATL19; At1g53010; F14G24.29; F8L10.17; Putative RING-H2 finger protein ATL19; RING-type E3 ubiquitin transferase ATL19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL19
Target Protein Sequence
MSSEEDDAISLISVLGLAVFIGLCILLVVLIATSALILVIYVIIDCILRPFLGTCLDLDL EIGVQRGQQRARIVTYHTIISTGLRLPDFEREGKKRGLKQSVIETLLPKLLVGQGNHEED EEKSLESRECAICLSGYVVNEECRVFPVCRHIYHALCIDAWLKNHLTCPTCRKDLPES
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G53010

STRING: 3702.AT1G53010.1

UniGene: At.66013

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the defining structural features of ATL19 as a member of the ATL family?

ATL19, as a member of the ATL family, would be expected to contain several characteristic domains and structural features. The defining features include a RING-H2 finger domain with a specific arrangement of zinc ligands where the fifth cysteine is replaced by a histidine residue . The protein would also contain a hydrophobic region likely functioning as a transmembrane domain at the N-terminal end, and potentially a GLD motif (named after conserved glycine, leucine, and aspartic acid residues) positioned between the transmembrane domain and the RING-H2 domain .

The RING-H2 domain of ATL proteins exhibits highly conserved spacing between the eight zinc ligands (six cysteines and two histidines) along with other conserved residues including a tryptophan positioned three residues downstream from the sixth zinc ligand . Additionally, ATL proteins typically contain conserved leucine following the second metal ligand, phenylalanine preceding the fifth ligand, tryptophan following four residues from the sixth ligand, and proline adjacent to the seventh ligand .

How does ATL19 typically compare with other members of the ATL family in terms of domain architecture?

While specific information about ATL19's domain architecture is not explicitly detailed in the literature, ATL family proteins generally share a common structural organization divided into approximately seven regions . This architecture includes:

  • The RING-H2 domain (region VI)

  • The hydrophobic/transmembrane region (region II)

  • The GLD domain (region IV)

  • Additional variable regions that may differ among ATL members

The precise arrangement of these domains and the presence of additional sequence motifs would determine how ATL19 relates to other ATL family members. Some ATLs contain specific sequence LOGOs in regions II and III that appear to correlate with functional properties. For example, the presence of arginine-rich motifs in region III and specific conserved residues in the GLD domain appear to be important for functional activity in some ATL members like ATL2 and ATL63 .

What is known about the evolutionary conservation of ATL19 across plant species?

The ATL family is plant-specific and has undergone significant expansion throughout plant evolution. While specific information about ATL19 conservation is not provided, the ATL family ranges from 20-28 members in basal species like Physcomitrella patens and Selaginella moellendorfii to 162 members in soybean, with Arabidopsis thaliana containing 91 members .

Evolutionary analyses of the ATL family have shown that approximately 60% of Oryza sativa (rice) ATLs cluster with A. thaliana ATLs, suggesting either expansion in rice or contraction in Arabidopsis since their divergence approximately 140-145 million years ago . This pattern of differential expansion makes the ATL family valuable for studying how gene families evolve in plant genomes .

What is the proposed biochemical function of ATL19 in the ubiquitination pathway?

As a putative RING-H2 finger protein, ATL19 likely functions as an E3 ubiquitin ligase within the ubiquitin proteasome system (UPS) . E3 ligases coordinate the transfer of ubiquitin to target proteins, marking them for degradation by the 26S proteasome.

The biochemical mechanism likely involves:

  • Interaction with an E2 ubiquitin-conjugating enzyme through the RING-H2 domain

  • Recognition of specific substrate proteins

  • Facilitation of ubiquitin transfer from the E2 to the substrate

ATL family E3 ligases typically interact with members of the Ubc4/Ubc5 subfamily of E2 conjugases, as demonstrated through both in vitro ubiquitination assays and yeast genetic interaction studies . The structural basis for this E2-E3 recognition has been elucidated for some ATL members, showing that specific amino acid residues within the RING-H2 domain are critical for E2 binding and subsequent ubiquitination activity .

What experimental evidence exists for ATL19's involvement in plant defense or stress responses?

While specific evidence for ATL19's role in plant defense is not explicitly provided in the literature, several members of the ATL family have been demonstrated to participate in defense responses . By inference, ATL19 may also function in this capacity.

ATL family proteins have been implicated in various plant defense mechanisms, with some members participating in the plant immune system. For instance, studies with other ATL family members have shown involvement in:

  • Response to pathogens

  • Regulation of defense signaling pathways

  • Mediation of responses to biotic and abiotic stresses

Experimental confirmation of ATL19's specific role in defense would require targeted studies such as gene expression analysis under pathogen challenge, phenotypic analysis of knockout/overexpression lines, and identification of defense-related interaction partners or substrates.

How might the transmembrane domain of ATL19 relate to its biological function?

The transmembrane domain in ATL proteins, including ATL19, likely serves critical functions related to subcellular localization and potentially substrate recognition . Based on studies of other transmembrane E3 ligases, this domain may:

  • Anchor the protein to cellular membranes (potentially the endoplasmic reticulum or plasma membrane)

  • Facilitate recognition of membrane-associated substrate proteins

  • Position the protein appropriately for interaction with the ubiquitination machinery

Transmembrane RING finger E3 ligases have been shown to participate in the endoplasmic reticulum-associated degradation (ERAD) pathway that targets misfolded proteins . Additionally, some transmembrane RING finger proteins interact with disease resistance proteins, as exemplified by RIN2 and RIN3 interactions with RPM1 .

The hydrophobic transmembrane region in ATL proteins is highly variable, defined by approximately 19 different sequence LOGOs , suggesting potential specialization for different cellular contexts or substrate specificities.

What are the optimal conditions for expression and purification of recombinant ATL19?

Based on general protocols for recombinant ATL family proteins, the following conditions could be considered for ATL19:

Expression System Options:

  • Bacterial expression (E. coli) for RING-H2 domain studies

  • Eukaryotic expression systems (yeast, insect cells) for full-length protein with proper folding

  • Plant expression systems for native conditions

Purification Considerations:

  • Tag selection (based on the search results, tag type is typically determined during the production process)

  • Buffer composition: Tris-based buffer with 50% glycerol is commonly used for stabilization

  • Storage conditions: -20°C for regular storage, -80°C for extended storage

  • Working aliquots can be maintained at 4°C for up to one week

Critical Notes:

  • Repeated freezing and thawing should be avoided to maintain protein integrity

  • The transmembrane domain may complicate purification of full-length protein, potentially requiring detergents or truncation strategies

What methods are most effective for studying ATL19's E3 ligase activity in vitro?

Effective methods for studying ATL19's E3 ligase activity would likely include:

In Vitro Ubiquitination Assays:

  • Components required:

    • Purified recombinant ATL19

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily)

    • Ubiquitin (potentially labeled for detection)

    • ATP and buffer components

    • Substrate protein (if known)

  • Detection methods:

    • Western blotting with anti-ubiquitin antibodies

    • Fluorescence-based assays with labeled ubiquitin

    • Mass spectrometry to identify ubiquitination sites

E2 Binding Assays:

  • Yeast two-hybrid assays

  • Pull-down assays

  • Surface plasmon resonance (SPR)

Studies with other ATL family members have shown good correlation between E3 activity and the degree of interaction between E2 enzymes and various RING domain mutants , suggesting that binding assays can provide valuable functional insights.

How can researchers effectively create and validate ATL19 mutants for structure-function studies?

An effective approach to creating and validating ATL19 mutants would include:

Mutant Design Strategy:

  • Target conserved residues in the RING-H2 domain, particularly:

    • Zinc-coordinating residues

    • Conserved residues identified in other ATLs as critical for E2 binding

    • The arginine-rich region (if present in ATL19) that may mediate E2 interaction

  • Mutations in the GLD motif to assess its functional significance

  • Modifications to the transmembrane domain to alter localization

Validation Approaches:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to assess proper folding

    • Nuclear magnetic resonance (NMR) spectroscopy for detailed structural analysis (as has been done for rice ATL EL5)

  • Functional validation:

    • In vitro ubiquitination assays with purified mutant proteins

    • Yeast complementation assays (using the toxicity of certain ATLs in yeast as a phenotypic readout)

    • E2 binding assays to correlate structural changes with interaction capability

  • In vivo validation:

    • Complementation of Arabidopsis atl19 mutants (if available)

    • Phenotypic analysis of plants expressing mutant versions

    • Subcellular localization studies using fluorescent protein fusions

How can ATL19 be utilized to study substrate specificity determinants in plant E3 ligases?

ATL19 could serve as a valuable model for investigating substrate specificity in plant E3 ligases through:

Domain Swap Experiments:

  • Creating chimeric proteins between ATL19 and other ATL family members with known substrates

  • Mapping regions responsible for substrate recognition

  • Identifying specific amino acid residues critical for substrate interactions

Proteomics Approaches:

  • Immunoprecipitation coupled with mass spectrometry to identify ATL19-interacting proteins

  • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity to ATL19 in vivo

  • Comparative analysis of ubiquitinated proteomes in wild-type versus atl19 mutant plants

Structural Biology:

  • Structural determination of ATL19 in complex with potential substrates

  • Computational modeling of substrate binding sites

  • Directed evolution approaches to alter substrate specificity

These approaches could reveal how ATL19's structure influences its target selection and how this specificity has evolved within the ATL family.

What is the current understanding of ATL19's potential role in the plant hormonal response network?

While specific information about ATL19's role in hormonal responses is not provided in the search results, several ATL family members have been implicated in hormone-related processes . Investigation of ATL19's potential role could involve:

Expression Analysis:

  • Monitoring ATL19 expression in response to various plant hormones

  • Comparing expression patterns with other hormone-responsive genes

  • Analyzing promoter elements for hormone-responsive elements

Genetic Approaches:

  • Phenotypic analysis of atl19 mutants under different hormonal treatments

  • Double mutant analysis with known hormone signaling components

  • Overexpression studies to identify hormone-related phenotypes

Biochemical Approaches:

  • Identification of ATL19 substrates involved in hormone signaling

  • Analysis of protein stability for hormone signaling components in atl19 mutants

  • Investigation of post-translational modifications of ATL19 in response to hormones

This research would contribute to understanding how the ubiquitin-proteasome system integrates with hormonal networks to regulate plant development and stress responses.

How might systems biology approaches advance our understanding of ATL19 within the broader context of plant ubiquitination networks?

Systems biology approaches could significantly enhance our understanding of ATL19 by:

Network Analysis:

  • Integrating protein-protein interaction data, expression profiles, and phenotypic data

  • Positioning ATL19 within the broader E3 ligase interactome

  • Identifying functional redundancy and specialization among ATL family members

Comparative Genomics:

  • Analyzing ATL19 orthologs across plant species

  • Correlating evolutionary conservation with functional importance

  • Identifying species-specific adaptations in ATL19 function

Multi-omics Integration:

  • Combining transcriptomics, proteomics, and metabolomics data from atl19 mutants

  • Developing predictive models of ATL19's influence on cellular processes

  • Identifying emergent properties not apparent from reductionist approaches

Quantitative Analysis of Ubiquitination Dynamics:

  • Developing mathematical models of ATL19-mediated substrate ubiquitination

  • Quantifying changes in the ubiquitinome under various conditions

  • Predicting system-wide effects of ATL19 perturbation

These approaches would help place ATL19 in its proper biological context and could reveal unexpected connections to diverse cellular processes.

What are common challenges when working with recombinant ATL19 and how can they be addressed?

Challenge 1: Protein Solubility and Stability

  • The transmembrane domain may cause aggregation or insolubility

  • Solution: Consider domain truncations, fusion tags that enhance solubility, or detergent-based extraction methods

  • Storage in optimized buffers containing 50% glycerol at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

Challenge 2: Maintaining Enzymatic Activity

  • E3 ligase activity may be sensitive to buffer conditions and protein modifications

  • Solution: Test multiple buffer conditions and include zinc in purification buffers to maintain RING finger structure

  • Consider co-expression with cognate E2 enzymes to stabilize the protein

  • Use activity assays immediately after purification to establish baseline activity

Challenge 3: Substrate Identification

  • Identifying physiological substrates is often difficult

  • Solution: Use proximity labeling approaches, proteomic comparison of ubiquitinated proteins in wild-type vs. mutants

  • Consider candidate approach based on known substrates of related ATL proteins

  • Validate potential substrates through multiple independent methods

How can researchers distinguish between ATL19-specific effects and redundant functions shared with other ATL family members?

Genetic Approaches:

  • Generate higher-order mutants with closely related ATL genes

  • Use CRISPR/Cas9 to create conditional knockouts or knockdowns

  • Employ tissue-specific or inducible expression systems to control ATL19 activity temporally and spatially

Biochemical Specificity:

  • Conduct detailed substrate specificity assays with purified proteins

  • Identify unique interaction partners through comparative proteomics

  • Determine binding affinities for different E2 enzymes to identify preferential interactions

Domain-Specific Functions:

  • Create chimeric proteins swapping domains between ATL19 and other family members

  • Identify unique structural features or post-translational modifications

  • Map substrate recognition domains that confer specificity

Evolutionary Analysis:

  • Compare conservation patterns across species

  • Identify ATL19-specific sequence features that have emerged through selection

  • Correlate species-specific functions with sequence divergence

What controls and validation steps are essential when studying ATL19's E3 ligase activity?

Essential Controls for E3 Ligase Assays:

Control TypePurposeImplementation
Negative controlsVerify specific activity1. Reactions without ATL19
2. Catalytically inactive ATL19 mutants (RING domain mutations)
3. Reactions without ATP
Positive controlsValidate assay functionality1. Well-characterized E3 ligase with known activity
2. Pre-validated E1/E2/ubiquitin components
Specificity controlsConfirm E2 selectivity1. Testing multiple E2 enzymes
2. Using E2 mutants with reduced binding capacity
Substrate controlsValidate target specificity1. Testing multiple potential substrates
2. Including known non-substrates
3. Using substrate mutants lacking ubiquitination sites

Validation Approaches:

  • Orthogonal activity assays (different detection methods)

  • Correlation between in vitro activity and in vivo phenotypes

  • Structural validation of proper protein folding

  • Mass spectrometry to confirm ubiquitination sites on substrates

  • Kinetic analyses to determine catalytic parameters

How might ATL19 function be affected by environmental stress conditions, and what methodologies could best investigate these potential relationships?

Research Approach Framework:

  • Expression Analysis Under Stress Conditions:

    • Quantitative RT-PCR or RNA-seq analysis of ATL19 expression under various stresses

    • Promoter-reporter fusions to visualize stress-responsive expression patterns

    • Comparison with expression patterns of known stress-responsive genes

  • Phenotypic Analysis:

    • Comparison of atl19 mutants and wild-type plants under stress conditions

    • Quantification of physiological parameters (reactive oxygen species, hormones, metabolites)

    • Complementation studies with stress-inducible promoters

  • Interaction Studies:

    • Identification of stress-specific protein interactions

    • Analysis of post-translational modifications under stress conditions

    • Investigation of altered substrate specificity during stress

  • Translational Regulation:

    • Polysome profiling to determine translational efficiency under stress

    • Analysis of protein stability and turnover rates during stress responses

    • Investigation of potential stress-induced alternative splicing

This research would help determine whether ATL19 functions as part of specific stress response pathways, similar to other characterized ATL family members involved in defense responses .

What computational approaches could advance structure-function analyses of ATL19 and other ATL family proteins?

Advanced Computational Methods:

  • Homology Modeling and Molecular Dynamics:

    • Generate structural models based on solved structures of related RING-H2 domains

    • Simulate protein dynamics to identify conformational changes during substrate or E2 binding

    • Predict effects of mutations on protein stability and function

  • Machine Learning Approaches:

    • Develop algorithms to predict substrate recognition patterns

    • Identify sequence features correlated with specific functions

    • Classify ATL proteins into functional subgroups based on sequence patterns

  • Systems-Level Modeling:

    • Model the dynamics of ubiquitination cascades involving ATL19

    • Integrate transcriptomic and proteomic data to predict regulatory networks

    • Simulate evolutionary scenarios to understand ATL family expansion

  • Structural Bioinformatics:

    • Analyze conservation patterns mapped onto structural models

    • Identify potential protein-protein interaction interfaces

    • Predict post-translational modification sites and their effects

These computational approaches could generate testable hypotheses about ATL19 function and guide experimental design for functional validation.

How might fundamental research on ATL19 contribute to our understanding of plant adaptation and evolution?

Research on ATL19 could contribute to evolutionary biology and plant adaptation through:

  • Comparative Genomics of ATL Family Expansion:

    • Analysis of ATL19 orthologs across diverse plant species

    • Correlation between environmental niches and ATL gene family composition

    • Investigation of selection pressures on different ATL domains

  • Functional Divergence Studies:

    • Characterization of substrate specificity shifts during evolution

    • Identification of novel functions acquired by ATL19 in specific lineages

    • Analysis of neo-functionalization versus sub-functionalization in the ATL family

  • Ecological and Evolutionary Significance:

    • Investigation of ATL19's role in species-specific adaptive responses

    • Analysis of natural variation in ATL19 sequences within species

    • Correlation between ATL19 polymorphisms and environmental adaptations

  • Contribution to Plant Evolutionary Theory:

    • Using the ATL family as a model for studying gene family evolution in plants

    • Understanding how E3 ligase diversity contributes to phenotypic plasticity

    • Exploring the role of protein turnover regulation in evolutionary adaptation

This research would extend beyond the molecular function of ATL19 to address fundamental questions about how protein degradation machinery contributes to plant evolution and adaptation to diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.