Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL21A (ATL21A)

Shipped with Ice Packs
In Stock

Description

Overview

Arabidopsis thaliana Putative RING-H2 Finger Protein ATL21A (ATL21A) is a protein that belongs to the RING-H2 finger protein family . RING-H2 finger proteins, also known as Really Interesting New Gene, are a class of E3 ubiquitin ligases characterized by a specific zinc-finger domain . These proteins play a crucial role in various plant processes, including growth, stress response, and signal transduction .

General Information

CategoryDescription
NameRecombinant Full Length Arabidopsis thaliana Putative RING-H2 Finger Protein ATL21A(ATL21A) Protein, His-Tagged
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
Protein LengthFull Length (21-372)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameATL21A
SynonymsATL21A; At2g46495; F11C10; F13A10; Putative RING-H2 finger protein ATL21A; RING-type E3 ubiquitin transferase ATL21A
UniProt IDP0CH01
AA SequenceSHPQQCSSSSCGRDDVHVRFPFWLLSKQPELCGHAGFNLQCTASPKTALKLPNSGTFLVREIDYLSQQIRLYDPENCLARKLLTFDISRSPFSALYLVSYTFLSCPNEVAKSSRFDSIPCLGNSTTSFLATTSLDLAKSMLPSCQIVKTLDVPVSRRVIAKKSRFSTDVNDKDLWLKWDSPSCSDCERDFLRCGFRSNTSLQVKCFPFENSGYNTEPQVLKIILLSIIGPLTIFATCIAVGVCTSERFASLIQRNVAIAALQPNEVIVTTGLDESIIESYKKTELGESRRLPGNNDDIVCPICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCPLCRNSPSPARQAV

Structure and Function

ATL21A contains a RING-H2 finger domain, a specialized type of zinc-finger motif that binds to E2 ubiquitin-conjugating enzymes, facilitating the transfer of ubiquitin to substrate proteins . This ubiquitination process is critical in regulating protein turnover, signal transduction, and various stress responses in plants . The Arabidopsis thaliana genome encodes a large number of RING-finger proteins, which are classified into different subtypes based on their structural characteristics, with RING-H2 being one of the most abundant .

Role in Stress Tolerance

RING-H2 finger proteins, including ATL21A, have been shown to play a significant role in plant stress tolerance . For example, the Arabidopsis RING-H2 gene, XERICO, confers drought tolerance by increasing abscisic acid (ABA) biosynthesis . Similarly, overexpression of the ShATL78L gene in S. lycopersicum enhances tolerance to drought and cold stresses . These proteins are involved in various abiotic and biotic stress signaling pathways .

Homologous Overexpression System

Arabidopsis thaliana is employed as a model for plant molecular biology . An Arabidopsis-based recombinant protein production platform has been developed for biochemical and structural studies . This system facilitates post-translational modifications and complex formation with endogenous interaction partners, which is useful when studying protein function .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL21A; At2g46495; F11C10; F13A10; Putative RING-H2 finger protein ATL21A; RING-type E3 ubiquitin transferase ATL21A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-372
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL21A
Target Protein Sequence
SHPQQCSSSSCGRDDVHVRFPFWLLSKQPELCGHAGFNLQCTASPKTALKLPNSGTFLVR EIDYLSQQIRLYDPENCLARKLLTFDISRSPFSALYLVSYTFLSCPNEVAKSSRFDSIPC LGNSTTSFLATTSLDLAKSMLPSCQIVKTLDVPVSRRVIAKKSRFSTDVNDKDLWLKWDS PSCSDCERDFLRCGFRSNTSLQVKCFPFENSGYNTEPQVLKIILLSIIGPLTIFATCIAV GVCTSERFASLIQRNVAIAALQPNEVIVTTGLDESIIESYKKTELGESRRLPGNNDDIVC PICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCPLCRNSPSPARQAV
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How can mutational analysis elucidate the functional domains of ATL21A?

Systematic mutational analysis represents a powerful approach to dissect the structure-function relationships of ATL21A's domains. Based on knowledge of the ATL family, a comprehensive mutational strategy should target several key regions:

  • RING-H2 domain mutations:

    • Site-directed mutagenesis of the conserved cysteine and histidine residues that coordinate zinc ions

    • Creation of specific point mutations (e.g., C→S or H→A) that disrupt zinc coordination while minimizing structural perturbations

    • Assessment of ubiquitin ligase activity using in vitro ubiquitination assays

    • Analysis of protein-protein interactions with E2 enzymes using yeast two-hybrid or pull-down assays

  • N-terminal hydrophobic domain mutations:

    • Systematic substitution of hydrophobic residues with charged or polar amino acids

    • Deletion analysis to determine the minimal region required for membrane association

    • Assessment of subcellular localization using fluorescent protein fusions

    • Evaluation of protein stability and function in planta

  • Potential substrate recognition domain mutations:

    • Based on homology with other ATL proteins, identification and mutation of region VII, which has been implicated in substrate recognition in ATL6 and ATL31

    • Alanine scanning mutagenesis of potential substrate-binding surfaces

    • Analysis of protein-protein interactions with candidate substrates

    • Phenotypic evaluation of plants expressing these mutant versions

DomainMutation TypeExperimental ReadoutExpected Outcome if Domain is Functional
RING-H2C/H to A/S substitutionsIn vitro ubiquitinationLoss of ubiquitin ligase activity
RING-H2DeletionE2 binding assaysAbolished interaction with E2 enzymes
HydrophobicHydrophobic to charged substitutionsSubcellular localizationAltered membrane association
Substrate recognitionAlanine scanningSubstrate bindingReduced interaction with targets
Potential phosphorylation sitesS/T to A or D/E substitutionsProtein activityAltered regulation
  • Functional validation in planta:

    • Generation of transgenic Arabidopsis lines expressing mutant variants under native or constitutive promoters

    • Complementation analysis in atl21a knockout backgrounds

    • Phenotypic characterization under various conditions

    • Analysis of target protein stability and ubiquitination in vivo

This systematic mutational approach enables the assignment of specific functions to different domains of ATL21A, providing mechanistic insights into its role as a RING-H2 ubiquitin ligase. The intronless nature of 90% of ATL genes, including likely ATL21A, suggests that the basic ATL protein structure evolved as a functional module , making domain analysis particularly informative.

  • What strategies can identify potential substrates of ATL21A?

Identifying the substrates of E3 ubiquitin ligases like ATL21A is crucial for understanding their biological functions. A multi-faceted approach combining biochemical, proteomic, and genetic strategies provides the most comprehensive identification strategy:

  • Affinity-based approaches:

    • Yeast two-hybrid (Y2H) screening using ATL21A as bait (excluding transmembrane domains)

    • Co-immunoprecipitation (Co-IP) with tagged ATL21A followed by mass spectrometry

    • In vitro pull-down assays using recombinant ATL21A protein

    • BioID or TurboID proximity labeling to capture transient interactions

  • Substrate trapping strategies:

    • Expression of catalytically inactive ATL21A mutants that can bind but not ubiquitinate substrates

    • Use of proteasome inhibitors to prevent substrate degradation

    • Tandem ubiquitin binding entities (TUBEs) to enrich ubiquitinated proteins

    • Ubiquitin remnant profiling to identify ubiquitinated lysines in potential substrates

  • Comparative proteomics:

    • Quantitative proteomics comparing wild-type and atl21a mutant plants

    • Identification of proteins that accumulate in the absence of ATL21A

    • Analysis of the ubiquitinome in wild-type versus atl21a mutants

    • Temporal proteomics after conditional expression of ATL21A

  • Genetic approaches:

    • Suppressor screens to identify mutations that rescue atl21a phenotypes

    • Synthetic lethality screens to identify genes with redundant functions

    • Analysis of genetic interactions through double mutant phenotyping

    • Transcriptome analysis to identify pathways affected by ATL21A disruption

  • Candidate-based approaches:

    • Testing of proteins known to be substrates of other ATL family members

    • Focus on 14-3-3 proteins, which have been identified as substrates of ATL6 and ATL31

    • Testing proteins involved in processes regulated by other ATL proteins, such as defense responses, carbon/nitrogen metabolism, or developmental transitions

ApproachAdvantagesLimitationsValidation Methods
Y2HDetects direct interactionsMay miss membrane-associated interactionsCo-IP, BiFC
Co-IP/MSIdentifies complexes in native conditionsMay include indirect interactionsIn vitro ubiquitination
Substrate trappingEnriches for true substratesRequires catalytic mutantsUbiquitination assays
Comparative proteomicsUnbiased, global approachIndirect evidenceTargeted degradation assays
Genetic screensIdentifies functional relationshipsLabor-intensiveBiochemical confirmation

For validation of potential substrates, in vitro and in vivo ubiquitination assays are essential, along with protein stability assays to demonstrate that ATL21A promotes the degradation of the identified substrates. Additionally, functional studies to understand the biological significance of these interactions are crucial for confirming the physiological relevance of the substrate.

  • How can ATL21A expression patterns inform its potential roles in plant development?

Analysis of ATL21A expression patterns provides critical insights into its potential biological functions during plant development. A comprehensive strategy to characterize expression patterns involves multiple complementary approaches:

  • Promoter-reporter fusion analysis:

    • Generation of transgenic Arabidopsis plants expressing β-glucuronidase (GUS) or fluorescent proteins under the control of the ATL21A promoter (pATL21A)

    • Histochemical staining or fluorescence imaging across different developmental stages and tissues

    • Quantitative analysis of expression levels in different cell types

    • Comparison with other ATL family members, such as ATL12, which has been shown to be expressed in roots, leaves, stems, and flowers

  • Transcriptome analysis:

    • Mining of publicly available RNA-seq datasets to determine ATL21A expression patterns

    • Generation of transcriptome data from specific tissues or developmental stages

    • Comparison with other ATL genes to identify potential functional redundancy

    • Co-expression analysis to identify genes with similar expression patterns

  • In situ hybridization:

    • Preparation of specific RNA probes for ATL21A mRNA

    • Hybridization with fixed tissue sections

    • Visualization of expression patterns at cellular resolution

    • Particularly valuable for detecting expression in specific cell types

  • Conditional expression analysis:

    • Monitoring ATL21A expression under various environmental conditions

    • Analysis of responses to biotic and abiotic stresses

    • Investigation of hormonal regulation, particularly in the context of defense responses

    • Comparison with the expression patterns of ATL12, which is upregulated after treatment with both salicylic acid and jasmonic acid

  • Single-cell RNA sequencing:

    • Analysis of ATL21A expression at single-cell resolution

    • Identification of cell-type specific expression patterns

    • Correlation with developmental trajectories

    • Integration with spatial information to create expression maps

Based on knowledge of other ATL family members, particular attention should be paid to:

  • Expression during embryogenesis, as ATL8 is mainly expressed in young siliques and may play a role during this process

  • Response to abscisic acid (ABA), as ATL43 shows an ABA-insensitive phenotype

  • Expression during defense responses, as several ATLs participate in this process

  • Involvement in carbon/nitrogen metabolism, as seen with ATL6 and ATL31

  • Expression during flowering transitions, as some ATLs regulate this process under short day conditions

By integrating these multiple approaches to characterize ATL21A expression patterns, researchers can generate hypotheses about its biological functions and design targeted experiments to test these hypotheses.

  • What are the optimal experimental designs for studying ATL21A's role in plant stress responses?

Investigating ATL21A's potential role in plant stress responses requires carefully designed experiments that account for biological variability and multiple stress conditions. Based on established experimental design principles in plant biology and knowledge of other ATL family members, the following approach is recommended:

  • Genetic materials preparation:

    • Generate multiple independent T-DNA insertion or CRISPR/Cas9-edited atl21a knockout lines

    • Create complementation lines expressing ATL21A under its native promoter

    • Develop overexpression lines with ATL21A under constitutive or inducible promoters

    • Include appropriate wild-type controls with matching genetic backgrounds

  • Experimental design considerations:

    • Implement a Latin Square design to control for environmental variables as described in statistical experimental design literature

    • Include sufficient biological replicates (minimum n=3, preferably n≥5) for statistical power

    • Conduct preliminary studies to determine appropriate sample sizes using power analysis

    • Incorporate proper randomization and blinding where possible

    • Include positive controls using stress-response mutants with known phenotypes

  • Stress treatments panel:

    • Biotic stress:

      • Fungal pathogens (e.g., Golovinomyces cichoracearum, as used for ATL12 studies )

      • Bacterial pathogens (e.g., Pseudomonas syringae)

      • Viral infections

      • Herbivory simulation using mechanical damage or insect feeding

      • Treatment with pathogen-associated molecular patterns (PAMPs) like chitin, which strongly induces ATL12

    • Abiotic stress:

      • Drought (controlled soil water content)

      • Salt stress (NaCl gradient treatments)

      • Temperature extremes (heat and cold shock)

      • Oxidative stress (H₂O₂, paraquat, etc.)

      • Nutrient deficiency/excess, particularly carbon/nitrogen imbalance

    • Hormone treatments:

      • Salicylic acid (SA)

      • Jasmonic acid (JA)

      • Ethylene

      • Abscisic acid (ABA)

      • Brassinosteroids

  • Phenotypic characterization:

    • Macroscopic phenotypes (growth parameters, visible stress symptoms)

    • Microscopic analysis (histochemical staining, cellular damage assessment)

    • Physiological measurements (photosynthetic efficiency, stomatal conductance)

    • Biochemical analyses (ROS levels, stress metabolites)

    • Molecular markers (expression of known stress-responsive genes)

  • Time-course analysis:

    • Early responses (minutes to hours) to capture signaling events

    • Intermediate responses (hours to days) for transcriptional and translational changes

    • Long-term responses (days to weeks) for developmental and adaptive changes

Experimental VariableControl StrategyMeasurement ApproachAnalysis Method
Genetic backgroundInclude multiple allelesGenotyping confirmationCompare multiple lines
Environmental variationLatin Square design Environmental sensorsANOVA with blocking
Treatment intensityDose-response curveQuantitative measurementsRegression analysis
Temporal dynamicsTime-course samplingSequential analysisTime-series statistics
Cellular heterogeneityCell-type specific analysisSingle-cell approachesClustering analysis

For defense responses specifically, methods similar to those used for studying ATL12 are recommended:

  • DAB (3,3′-diaminobenzidine) staining to assess ROS production

  • RT-PCR to measure expression of defense genes

  • Analysis of respiratory burst oxidase homolog protein D/F (AtRBOHD/F) expression

  • Assessment of MAPK cascade activation

This comprehensive experimental design will provide robust data on ATL21A's potential role in plant stress responses, particularly in defense mechanisms where other ATL family members have demonstrated involvement.

  • How can multi-omics approaches be integrated to understand ATL21A function?

Integrating multi-omics approaches provides a comprehensive understanding of ATL21A function within the complex cellular network of Arabidopsis thaliana. This systems biology strategy combines data from multiple molecular levels to generate holistic insights into protein function:

  • Genomics approaches:

    • Whole-genome sequencing of atl21a mutant lines to confirm mutations and identify potential off-target effects

    • Natural variation analysis of ATL21A across Arabidopsis accessions, similar to approaches used in other A. thaliana population studies

    • Evolutionary analysis compared to the 121 ATL members identified in rice (Oryza sativa)

    • CRISPR/Cas9-mediated genome editing to create precise mutations in functional domains

  • Transcriptomics integration:

    • RNA-Seq analysis comparing wild-type, atl21a knockout, and ATL21A overexpression lines

    • Identification of differentially expressed genes and enriched pathways

    • Co-expression network analysis to position ATL21A within functional modules

    • Comparison with transcriptome data from other ATL family member mutants

  • Proteomics approaches:

    • Quantitative proteomics to identify proteins with altered abundance in atl21a mutants

    • Ubiquitinome analysis to identify changes in protein ubiquitination patterns

    • Phosphoproteomics to detect alterations in signaling pathways

    • Protein-protein interaction mapping using immunoprecipitation-mass spectrometry

  • Metabolomics integration:

    • Targeted and untargeted metabolite profiling of atl21a mutants

    • Identification of metabolic pathways affected by ATL21A function

    • Integration with transcriptome and proteome data to map metabolic flux changes

    • Analysis of specific metabolites related to defense responses or stress signaling

  • Phenomics approaches:

    • High-throughput phenotyping under various environmental conditions

    • Quantitative trait analysis linking molecular changes to phenotypic outcomes

    • Comparison of developmental parameters with wild-type plants

    • Machine learning-based pattern recognition to identify subtle phenotypic changes

  • Data integration frameworks:

    • Network-based integration of multi-omics data

    • Pathway enrichment analysis across multiple data types

    • Bayesian networks to infer causal relationships

    • Machine learning approaches to identify predictive features

Omics LevelKey TechnologiesSpecific Applications for ATL21AIntegration Strategy
GenomicsWhole-genome sequencing, CRISPR/Cas9Mutation confirmation, variant analysisGenetic basis for other omics
TranscriptomicsRNA-Seq, microarraysExpression changes, co-expression networksInput for pathway analysis
ProteomicsLC-MS/MS, ubiquitin remnant profilingSubstrate identification, signaling changesProtein-protein interaction networks
MetabolomicsGC-MS, LC-MSMetabolic impacts, defense compoundsMetabolic pathway mapping
PhenomicsAutomated imaging, growth analysisStress responses, developmental changesEndpoint for functional impact
  • Temporal and spatial considerations:

    • Time-course experiments to capture dynamic changes across omics levels

    • Tissue-specific and cell-type-specific analyses to address spatial heterogeneity

    • Developmental stage comparisons to identify stage-specific functions

    • Stress response dynamics to understand ATL21A's role in adaptation

By integrating these multi-omics approaches, researchers can develop a comprehensive understanding of ATL21A's function within the plant cellular network, identifying its substrates, regulatory mechanisms, and physiological roles. This systems-level understanding will position ATL21A within the broader context of plant biology and elucidate how this particular RING-H2 ubiquitin ligase contributes to plant development and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.