ATL21C belongs to the ATL family of proteins, which was named after ATL2, the first identified member that exhibited toxic effects when overexpressed in Saccharomyces cerevisiae . The ATL family represents a significant group of RING-finger domain proteins that function as E3 ubiquitin ligases within the ubiquitin proteasome system . These proteins coordinate the transfer of ubiquitin to target proteins, marking them for degradation by the 26S proteasome.
The ATL family is notably prolific in plants, with studies identifying numerous members across different plant species. In Arabidopsis thaliana alone, the family comprises multiple members, each potentially serving distinct roles in plant cellular processes . These proteins are classified as single-subunit RING finger E3s, containing both the substrate recognition sequences and the catalytic RING-H2 domain within the same polypeptide .
ATL21C is encoded by the gene AT2g46493 in Arabidopsis thaliana and is also known by several synonyms including "Putative RING-H2 finger protein ATL21C" and "RING-type E3 ubiquitin transferase ATL21C" . The gene is associated with the loci F11C10 and F13A10 on chromosome 2 of the Arabidopsis genome . In protein databases, ATL21C is identified by the UniProt ID P0CH03 .
ATL21C exhibits the characteristic structural features common to the ATL family of proteins. The protein contains a transmembrane domain at the amino-terminal end and a RING-H2 finger domain . The RING-H2 domain represents a variation of the canonical RING finger domain, where the fifth cysteine residue is replaced by a histidine residue .
A hydrophobic region that functions as a transmembrane domain
The GLD motif, a conserved sequence located between the transmembrane domain and the RING-H2 domain, named for its glycine, leucine, and aspartic acid residues
The RING-H2 finger domain with its characteristic arrangement of zinc-coordinating residues
The RING-H2 domain in ATL proteins typically contains six cysteines and two histidines that coordinate zinc ions, along with a conserved tryptophan residue positioned three residues downstream from the sixth zinc ligand . This specific arrangement is critical for the domain's structural integrity and function in binding to E2 ubiquitin-conjugating enzymes.
The recombinant form of ATL21C encompasses amino acids 24-366 of the mature protein . The complete amino acid sequence of this recombinant form is presented in Table 1.
| Sequence |
|---|
| SNPNNCSSSSSRPLRCGPLEVPIRFPFCNHARFNLHCTDLNKTVLELPMSGTFLVRDIDY |
| RRQKIYINDPNCLAKRLLTFNISGSPFSPHFDILYTFLSCPNEVVLPSWYPSIPCLSNST |
| SSFFATSNYSLAQSMLPSCQIVKRLHVPATSPFGETRFSSDLNNQSLLLEWALPDCRAKC |
| LGATKKTGTIYNSNIFSCSFSFLYDSRELFINGNLSSGVLVLVISLSAVTVFVFPTCIAI |
| RLYDSERFDSAIAAATVMQQPREVMARRGLDQSTIETFKKMELGESRRLSGTNGIVCPIC |
| LSEYASKETVRFIPECDHCFHVECIDVWLKIHGSCPLCRNSCA |
This sequence contains the specific arrangement of cysteine and histidine residues that form the RING-H2 domain, which is essential for the protein's function as an E3 ubiquitin ligase . The sequence also likely includes regions corresponding to the transmembrane domain and the conserved GLD motif characteristic of ATL family proteins.
As a member of the ATL family, ATL21C is presumed to function as an E3 ubiquitin ligase within the ubiquitin-proteasome system . The RING-H2 finger domain in ATL proteins directly binds to E2 ubiquitin-conjugating enzymes, facilitating the transfer of ubiquitin to specific target proteins . This ubiquitination process marks proteins for degradation by the 26S proteasome, representing a critical mechanism for protein turnover and cellular regulation in plants.
Studies with other ATL proteins have shown that they typically rely on members of the Ubc4/Ubc5 subfamily of E2 conjugases for their ubiquitination activity . The structural basis for this E2-E3 recognition has been investigated in some ATL family members, such as rice EL5, revealing key amino acid residues in the RING-H2 domain that are essential for binding to E2 enzymes . A good correlation between E3 activity and the degree of interaction between the E2 enzyme and various RING domain mutants has been observed in these studies .
While the specific biological functions of ATL21C have not been extensively characterized in the available literature, insights can be drawn from research on other ATL family members. ATL proteins are implicated in various cellular processes and responses in plants, including:
Plant development and growth regulation
Response to biotic and abiotic stresses
Hormone signaling pathways
Protein quality control
The transmembrane domain suggests that ATL21C may be localized to a cellular membrane, potentially the plasma membrane or an organelle membrane, which could indicate its involvement in membrane-associated protein turnover or signaling pathways . This membrane association is a characteristic feature of ATL proteins and likely plays a role in their specific cellular functions.
The recombinant ATL21C protein is produced in Escherichia coli expression systems . The protein is expressed as a fusion with an N-terminal histidine tag (His-tag), which facilitates purification using affinity chromatography techniques . The recombinant protein corresponds to amino acids 24-366 of the mature ATL21C protein (UniProt ID: P0CH03) .
The recombinant ATL21C protein exhibits specific physical and biochemical properties that are important for its handling and application in research settings. These properties are summarized in Table 2.
| Property | Description |
|---|---|
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage Buffer | Tris/PBS-based buffer with 6% Trehalose, pH 8.0 |
| Recommended Storage | -20°C/-80°C upon receipt, aliquoting necessary for multiple use |
| Reconstitution | Reconstitute in deionized sterile water to 0.1-1.0 mg/mL |
| Stability | Working aliquots stable at 4°C for up to one week; avoid repeated freeze-thaw cycles |
The protein's high purity (>90%) makes it suitable for various biochemical and structural studies . The inclusion of trehalose in the storage buffer helps to maintain protein stability during lyophilization and storage .
Proper handling of recombinant ATL21C is essential for maintaining its structural integrity and functional activity. The recommended reconstitution protocol includes the following steps :
Briefly centrifuge the vial prior to opening to bring the contents to the bottom
Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) for long-term storage
Aliquot the reconstituted protein to minimize freeze-thaw cycles
Recombinant ATL21C can serve various research purposes in plant molecular biology, including:
Protein-Protein Interaction Studies: The protein can be used to investigate interactions with potential E2 ubiquitin-conjugating enzymes and substrate proteins, contributing to our understanding of the ubiquitination pathway in Arabidopsis thaliana.
Structural Studies: The purified protein may be utilized for structural analyses, such as crystallography or NMR spectroscopy, to elucidate the three-dimensional structure of the RING-H2 domain and its binding interfaces.
Enzymatic Assays: In vitro ubiquitination assays can be performed to assess the E3 ligase activity of ATL21C and identify its specific substrate proteins.
Antibody Production: The recombinant protein can serve as an antigen for generating antibodies against ATL21C, which would be valuable tools for immunolocalization and immunoprecipitation studies.
Studies with other ATL family members have shown that structural characteristics of the RING-H2 domain influence their interaction with E2 enzymes and subsequent ubiquitination activity . Similar investigations with ATL21C could provide insights into its specific functional properties and biological roles in plant cells.
Research on ATL21C contributes to the broader understanding of protein ubiquitination in plants, which plays roles in numerous biological processes. The ubiquitin-proteasome system regulates protein turnover and is involved in various cellular responses, including:
Plant growth and development regulation
Responses to environmental stresses
Hormone signaling pathways
Defense against pathogens
The Arabidopsis thaliana interactome includes over 95,000 protein-protein interactions, involving approximately 46% of the proteins encoded by the genome . Understanding the specific interactions of ATL21C within this complex network could provide valuable insights into its biological functions and regulatory roles in plant cellular processes.
KEGG: ath:AT2G46493
UniGene: At.75546
ATL21C (Arabidopsis Tóxicos en Levadura 21C) belongs to the RING-H2-type E3 ubiquitin ligase family in Arabidopsis thaliana. While specific published research on ATL21C is limited, it shares structural similarities with other ATL family members like ATL2, featuring a RING-H2 finger domain critical for ubiquitin ligase activity. The ATL family in Arabidopsis functions within the ubiquitin/26S proteasome system, which regulates numerous cellular processes including signal transduction, transcriptional regulation, and responses to biotic and abiotic stressors . The protein structure of ATL21C has been computationally modeled, though it's important to note that there are currently no experimental data to verify the accuracy of this model .
Based on studies of related ATL proteins such as ATL2, many ATL family members are localized to the plasma membrane. For example, ATL2 has been confirmed to be integrated into the plasma membrane through bioinformatics analysis, live-cell confocal imaging, and cell fractionation studies . When investigating ATL21C localization, researchers should employ similar techniques including:
Fluorescent protein fusion constructs (GFP/YFP-ATL21C) for live cell imaging
Cell fractionation followed by Western blot analysis
Immunolocalization with specific antibodies
Bioinformatic analysis of transmembrane domains and signal peptides
These approaches can help determine whether ATL21C shares the plasma membrane localization pattern observed in ATL2 or has distinct subcellular targeting.
While specific ATL21C expression patterns haven't been extensively documented, we can extrapolate from studies of ATL2, which shows induced expression in response to pathogen-associated molecular patterns. ATL2 expression is low under normal growth conditions but is rapidly and significantly induced by exogenous chitin treatment . To investigate ATL21C expression patterns:
Perform quantitative RT-PCR experiments comparing expression under various stress conditions (pathogens, abiotic stresses, hormones)
Generate promoter-reporter fusions (ATL21C promoter:GUS) to visualize tissue-specific expression patterns
Analyze expression level polymorphisms (ELPs) across different Arabidopsis accessions
Compare expression with other ATL family members to identify potential functional redundancy or specialization
Expression level polymorphism has been shown to be one mechanism causing phenotypic variation in Arabidopsis responses to stressors , so examining ATL21C expression across accessions may reveal natural variation in its regulation.
To investigate ATL21C protein stability and turnover:
Cycloheximide chase assays: Treat plant tissue expressing tagged ATL21C with cycloheximide to inhibit protein synthesis, then monitor protein levels over time to measure degradation rates
Proteasome inhibitor studies: Apply MG132 or other proteasome inhibitors to determine if ATL21C is regulated by the 26S proteasome
In vivo ubiquitination assays: Immunoprecipitate ATL21C from plant extracts and probe for ubiquitin to detect ubiquitination status
Pulse-chase experiments with labeled amino acids to track newly synthesized protein fate
Studies of ATL2 showed that its protein stability significantly increases following chitin treatment, and its degradation is prolonged when 26S proteasomal function is inhibited . Similar experiments with ATL21C would help determine if its regulation follows comparable patterns.
Based on methodologies used for other ATL family members, a comprehensive phenotypic characterization of ATL21C should include:
Generation and analysis of knockout/knockdown lines (T-DNA insertion mutants, CRISPR-Cas9 edited lines, or RNAi)
Development of overexpression lines using constitutive or inducible promoters
Complementation studies to verify phenotypes are specifically due to ATL21C disruption
Comparative analysis with wild-type plants under various stress conditions:
Pathogen challenge (bacterial, fungal pathogens)
Abiotic stressors (drought, salt, temperature, nutrient deficiency)
Hormone treatments
When examining ATL2 function, researchers found that atl2 null mutants exhibited higher susceptibility to Alternaria brassicicola, while plants overexpressing ATL2 displayed increased resistance . This suggests ATL21C might similarly be involved in pathogen defense responses, though it could have divergent or additional functions.
To confirm and characterize the E3 ubiquitin ligase activity of ATL21C:
In vitro assays:
Recombinant protein expression and purification (bacterial, insect, or plant-based)
In vitro ubiquitination assays including E1, E2, ATP, ubiquitin, and ATL21C
Site-directed mutagenesis of critical residues in the RING-H2 domain followed by activity assays
In vivo approaches:
Co-immunoprecipitation to identify interacting proteins (E2 enzymes, substrates)
Bimolecular fluorescence complementation (BiFC) to verify protein interactions
Cell-free degradation assays with potential substrate proteins
In planta ubiquitination assays
Research on ATL2 demonstrated that the cysteine 138 residue is critical for its E3 ubiquitin ligase function . Similar structure-function studies should be conducted for ATL21C, focusing on conserved residues within the RING-H2 domain.
Identifying E3 ligase substrates remains challenging but several complementary approaches can be employed:
Yeast two-hybrid screening: Use ATL21C as bait to screen Arabidopsis cDNA libraries
Affinity purification coupled with mass spectrometry (AP-MS): Use tagged versions of ATL21C to pull down interacting proteins
Proximity-dependent labeling: Use techniques like BioID or TurboID fused to ATL21C to label proteins in close proximity
Comparative proteomics: Compare proteomes of wild-type and atl21c mutants to identify proteins with altered abundance
Ubiquitinome analysis: Identify changes in ubiquitinated proteins between wild-type and atl21c mutant plants
Additional validation of putative substrates should include:
In vitro ubiquitination assays with recombinant proteins
Analysis of substrate protein stability in wildtype vs. atl21c backgrounds
Confirmation of physical interaction through co-immunoprecipitation and BiFC
To place ATL21C within broader signaling networks:
Transcriptome analysis: Compare RNA-seq data between wild-type and atl21c mutants under various conditions
Co-expression network analysis: Identify genes with expression patterns that correlate with ATL21C
Epistasis analysis: Generate double mutants between atl21c and other signaling pathway components
Regulatory element analysis: Examine ATL21C promoter for binding sites of known transcription factors
Studies of the ATL family member AtALMT1 revealed complex co-expression networks including genes involved in root meristem growth, microtubule organization, and protein processing in the endoplasmic reticulum . Similar network analyses could reveal whether ATL21C participates in these or distinct cellular processes.
| Network Component | Potential Function | Experimental Approach |
|---|---|---|
| Protein processing in ER | Quality control of proteins | Co-expression analysis, double mutant phenotyping |
| Microtubule organization | Cell wall synthesis, cell division | Cytoskeletal staining in mutants |
| ROS signaling | Stress responses | Measure ROS levels in mutants |
| Root meristem regulation | Growth control | Root meristem analysis |
The choice of expression system depends on experimental goals:
Bacterial expression (E. coli):
Advantages: High yield, fast, inexpensive
Limitations: May lack proper folding, post-translational modifications
Best for: Truncated versions (e.g., RING domain only), preliminary activity assays
Insect cell expression:
Advantages: Better folding, some post-translational modifications
Limitations: More expensive, technically demanding
Best for: Full-length protein, structural studies
Plant expression systems:
Advantages: Native post-translational modifications, proper folding
Options: Transient expression (N. benthamiana), stable expression (Arabidopsis)
Best for: Functional studies, identifying interacting partners
Protein purification should include careful optimization of buffer conditions, as membrane-associated proteins like ATL family members can be challenging to maintain in solution with proper folding.
Multiple genomic approaches can be integrated to understand ATL21C function:
Genome-wide association studies (GWAS): Identify natural variation in ATL21C sequence or expression associated with phenotypic differences across Arabidopsis accessions
Expression level polymorphism (ELP) analysis: Compare ATL21C expression across accessions to identify regulatory variation
Promoter sequence analysis: Examine natural variation in the ATL21C promoter to identify regulatory elements
Genomic prediction (GP): Assess cumulative effects of associated loci
Studies on other Arabidopsis genes demonstrated that integration of GWAS with genomic prediction and co-expression network analysis improves sensitivity and accuracy . For ATL21C, researchers should consider analyzing:
Promoter sequence polymorphisms across accessions
Expression level variation and its correlation with stress responses
Protein sequence polymorphisms that might affect function
A comparative analysis approach should include:
Phylogenetic analysis of the ATL family in Arabidopsis to determine evolutionary relationships
Comparative phenotypic analysis of multiple atl mutants under the same conditions
Domain structure comparison focusing on conserved and divergent regions
Cross-complementation experiments (expressing ATL21C in other atl mutants)
The ATL family in Arabidopsis contains numerous members with potentially overlapping functions. ATL2, for example, has been shown to be essential for defense responses against fungal pathogens . Determining whether ATL21C has similar or distinct functions requires direct comparative analysis.
Analysis of ATL21C structure should focus on:
Comparison with experimentally determined structures of other RING-H2 domains
Analysis of key residues in the RING-H2 domain required for zinc coordination and E2 interaction
Identification of unique structural features outside the RING domain
Although experimental structure data for ATL21C is lacking , computational models can provide valuable insights into potential functional sites. Researchers should analyze:
Conservation of zinc-coordinating residues in the RING-H2 domain
Presence of transmembrane domains or other targeting sequences
Unique motifs that might confer substrate specificity
Several cutting-edge technologies could significantly enhance ATL21C research:
CRISPR-Cas9 gene editing: Generate precise mutations in ATL21C or regulatory elements
Single-cell transcriptomics: Examine cell-type specific expression patterns
Cryo-electron microscopy: Determine high-resolution structures of ATL21C alone or in complex with substrates
Proximity labeling proteomics: Identify proteins in close proximity to ATL21C in vivo
Optogenetics: Control ATL21C activity with light to study temporal dynamics
Key outstanding questions include:
What are the direct substrates of ATL21C?
How is ATL21C expression and activity regulated post-transcriptionally?
Does ATL21C function redundantly with other ATL family members?
What environmental conditions specifically require ATL21C function?
How does ATL21C contribute to plant fitness in natural environments?
Addressing these questions will require integrating multiple experimental approaches and potentially studying ATL21C function across diverse Arabidopsis accessions to understand its ecological relevance.