Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL37 (ATL37)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL37 (ATL37) is a protein that, in Arabidopsis thaliana, is associated with several pathways and biochemical functions . It belongs to the Arabidopsis Tóxicos en Levadura (ATL) family of RING-H2 E3 ubiquitin ligases .

Characteristics of RING-H2 Finger Proteins

  • Structure RING finger proteins are a type of zinc finger protein that bind two zinc atoms . They contain 40–60 residues and the RING finger motif is defined as Cys-X2-Cys-X(9–39)-Cys-X(1–3)-His-X(2–3)-Cys/His-X2-Cys-X(4–48)-Cys-X2-Cys, where X is any amino acid .

  • Function RING-finger proteins participate in plant growth, stress resistance, and signal transduction . They also have roles in viral replication, signal transduction, and development . The RING finger domain mediates binding to an E2 ubiquitin-conjugating enzyme . As E3 ubiquitin ligases, they are involved in the ubiquitination pathway .

The ATL Family

The Arabidopsis Tóxicos en Levadura (ATL) family consists of 91 members in Arabidopsis thaliana that contain the RING-H2 variation and a hydrophobic domain at the N-terminal end . The ATL subfamily encodes proteins with the RING-H2 domain and transmembrane domain . Common features of all members of the family include the RING-H2 domain, a region rich in hydrophobic amino acid residues, and a region named GLD .

Function of ATL37

ATL37 is involved in several pathways and biochemical functions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
ATL37; At4g09130; F23J3.160; T8A17.9; Putative RING-H2 finger protein ATL37; RING-type E3 ubiquitin transferase ATL37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-357
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL37
Target Protein Sequence
QQGSESAGRNGKSKESSIIGIVLLSLFLLLLVVYCLNYGCCIEENETGGHEVLHSRVRRG IDKDVIESFPAFLYSEVKAFKIGNGGVECAICLCEFEDEEPLRWMPPCSHTFHANCIDEW LSSRSTCPVCRANLSLKSGDSFPHPSMDVETGNAQRGVQESPDERSLTGSSVTCNNNANY TTPRSRSTGLLSSWHVPELFLPRSHSTGHSLVQPCQNIDRFTLQLPEEVQRQLVSLNLIK RSHIALPRARSSRQGYRSGSVGNERTGFSQGRQTLRRAISTSLSFSFQPAPVRSTLDRDN LMRETSQANDKDFGERSFQRLMPEKN
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL37 and what is its role in Arabidopsis thaliana?

ATL37 (also known as At4g09130) is a member of the Arabidopsis Tóxicos en Levadura (ATL) family of proteins, characterized by a RING-H2 finger domain. This protein functions as an E3 ubiquitin ligase, which plays a critical role in the ubiquitin-proteasome system for targeted protein degradation in plants .

As a RING-type E3 ubiquitin transferase, ATL37 is involved in:

  • Protein degradation signaling pathways

  • Plant stress responses

  • Developmental processes regulation

  • Hormone signaling networks

The full-length mature protein spans amino acids 32-357 and contains the characteristic RING-H2 domain that is essential for its E3 ligase activity .

What structural domains characterize ATL37 protein?

ATL37 contains several conserved structural domains that are typical of the ATL family of RING-H2 proteins :

Domain/RegionPositionFunction
RING-H2 fingerCentral regionE3 ubiquitin ligase activity; binds to E2 enzymes
Hydrophobic regionN-terminalPotential transmembrane domain
GLD motifVariable positionConserved motif of unknown function
N-terminal signal sequence1-31Targeting/localization signal

The RING-H2 finger domain specifically contains a characteristic arrangement of 8 zinc ligands with a defined pattern: the 4th and 5th metal coordinating residues are histidines (H) while the others are cysteines (C) . This domain has the consensus sequence: C-X₂-C-X₉-₃₉-C-X₁-₃-H-X₂-₃-H-X₂-C-X₄-₄₈-C-X₂-C, where X represents any amino acid and subscripts indicate the number of residues .

How is recombinant ATL37 protein typically expressed and purified?

Recombinant ATL37 protein is typically expressed and purified using the following protocol :

  • Expression system: E. coli is the preferred host for expression

  • Construct design:

    • Full-length mature protein (amino acids 32-357)

    • N-terminal His-tag for purification

    • Cloned into an appropriate expression vector

  • Expression conditions:

    • Induction with IPTG (0.5-1 mM)

    • Expression at 16-25°C for 16-20 hours (lower temperatures help with solubility)

    • Use of E. coli strains optimized for protein expression (BL21(DE3) or Rosetta)

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Buffer containing 6% trehalose in Tris/PBS-based buffer at pH 8.0

    • Elution with imidazole gradient

    • Further purification may include ion exchange or size exclusion chromatography

  • Storage and handling:

    • Lyophilized powder form

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

What is the difference between RING-HC and RING-H2 domains?

The distinction between RING-HC and RING-H2 domains lies in their metal-ligand arrangement :

FeatureRING-HCRING-H2
Metal-binding patternC₁-C₂-C₃-H₄-C₅-C₆-C₇-C₈C₁-C₂-C₃-H₄-H₅-C₆-C₇-C₈
Number of histidines1 (position 4)2 (positions 4 and 5)
Number of cysteines76
Prototypical examplec-CblATL family proteins

The specific arrangement of histidine residues influences the three-dimensional structure of the zinc-coordinating domain, which may affect protein-protein interactions, particularly with E2 ubiquitin-conjugating enzymes. RING-H2 domains, like those found in ATL37, are particularly prevalent in the Arabidopsis genome compared to other eukaryotes .

How can I assess the E3 ubiquitin ligase activity of recombinant ATL37 in vitro?

The E3 ubiquitin ligase activity of recombinant ATL37 can be assessed through various biochemical assays:

A. In vitro ubiquitination assay:

  • Reaction components:

    • Purified recombinant ATL37 (0.1-1 μg)

    • E1 ubiquitin-activating enzyme (50-100 nM)

    • E2 ubiquitin-conjugating enzyme (0.5-1 μM) (test multiple E2s to identify specific pairing)

    • Ubiquitin (10-50 μM)

    • ATP regeneration system (2 mM ATP, 10 mM creatine phosphate, 3.5 U/mL creatine kinase)

    • Reaction buffer (50 mM Tris-HCl pH 7.5, 5 mM MgCl₂, 2 mM DTT)

  • Incubate the reaction at 30°C for 1-2 hours.

  • Terminate by adding SDS-PAGE sample buffer with reducing agent.

  • Analyze by western blot using anti-ubiquitin antibodies.

  • Controls should include reactions missing individual components.

B. Autoubiquitination detection:
Since many RING-H2 E3 ligases undergo autoubiquitination, this can be detected using anti-His antibodies (for the His-tagged ATL37) to observe the characteristic ladder pattern of ubiquitinated proteins.

C. Substrate identification and validation:

  • Use yeast two-hybrid or pull-down assays to identify potential substrates

  • Validate substrates by including them in the in vitro ubiquitination assay

  • Perform substrate competition assays to confirm specificity

The key to successful activity assessment is using appropriate E2 enzymes, as ATL37 may have specificity for certain E2 partners. Testing a panel of Arabidopsis E2s is recommended to determine optimal pairing .

What are the key considerations when designing experiments to study ATL37 gene function in planta?

When designing experiments to study ATL37 function in Arabidopsis, several key considerations should be addressed:

A. Genetic approaches:

  • T-DNA insertion lines:

    • Check available knockout/knockdown lines in repositories like ABRC or NASC

    • Verify the insertion location by PCR and sequencing

    • Confirm gene disruption by RT-PCR or qPCR

    • Screen homozygous mutants for phenotypes under various conditions

  • CRISPR/Cas9 gene editing:

    • Design sgRNAs targeting the RING-H2 domain for function disruption

    • Use multiplex CRISPR to target redundant ATL family members simultaneously

    • Generate point mutations in zinc-coordinating residues to disrupt E3 activity while maintaining protein structure

  • Overexpression studies:

    • Use constitutive (35S) or inducible promoters

    • Create fusion proteins with fluorescent tags for localization studies

    • Consider tissue-specific promoters to study function in specific cell types

B. Expression pattern analysis:

  • Generate promoter-reporter constructs (pATL37::GUS or pATL37::GFP)

  • Use Traffic Lines (TLs) from Arabidopsis to track inheritance and expression patterns

  • Apply laser capture microdissection (LCM) with subsequent RNA analysis to determine tissue-specific expression

C. Stress response studies:
Since ATL family members often respond to stress signals, design experiments to test:

  • Abiotic stress treatments (drought, salt, cold, heat)

  • Hormone treatments (particularly ABA, ethylene, jasmonate, salicylic acid)

  • Biotic stress challenges (pathogens, herbivory)

  • Measure gene expression using qRT-PCR under these conditions

D. Protein interaction studies:

  • Identify E2 partners using yeast two-hybrid or pull-down assays

  • Perform co-immunoprecipitation to validate interactions in planta

  • Use bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

E. Substrate identification:

  • Employ immunoprecipitation followed by mass spectrometry

  • Compare proteomes of wildtype and atl37 mutants to identify accumulated proteins

  • Validate potential substrates through direct interaction and ubiquitination assays

When analyzing results, consider potential functional redundancy with other ATL family members, which may mask phenotypes in single mutants .

How can flow cytometry be used to analyze protein expression patterns in transgenic Arabidopsis expressing ATL37?

Flow cytometry provides a powerful approach for analyzing protein expression patterns in transgenic Arabidopsis expressing ATL37, particularly when combined with fluorescent reporter systems. Based on methodologies adapted from other plant studies , the following protocol can be implemented:

A. Transgenic line construction:

  • Generate fusion constructs of ATL37 with fluorescent proteins (GFP, YFP, or mCherry)

  • Create promoter-reporter constructs (pATL37::fluorescent protein) to study native expression patterns

  • Develop inducible expression systems to control ATL37 expression temporally

B. Sample preparation for flow cytometry:

  • Protoplast isolation:

    • Collect plant tissue (leaves, roots, or seedlings)

    • Digest with cellulase and macerozyme (1-1.5% each) in buffer containing 0.4M mannitol, 20mM KCl, 20mM MES (pH 5.7)

    • Incubate at room temperature for 3-4 hours with gentle shaking

    • Filter through 40-50μm mesh to remove debris

    • Wash protoplasts in W5 buffer (154mM NaCl, 125mM CaCl₂, 5mM KCl, 2mM MES pH 5.7)

  • Cell fixation (optional):

    • Fix protoplasts in 1-2% paraformaldehyde for 10 minutes

    • Wash in PBS or W5 buffer

C. Flow cytometry analysis:

  • Analyze samples on a flow cytometer equipped with appropriate lasers for fluorescent protein excitation

  • Set gates based on:

    • Forward scatter (FSC) and side scatter (SSC) to identify intact protoplasts

    • Autofluorescence controls to distinguish true signal from background

    • Fluorescence intensity to quantify expression levels

  • Collect data for multiple parameters:

    • Cell size (FSC)

    • Cell complexity (SSC)

    • Fluorescence intensity (protein expression level)

    • Cell viability (with appropriate dyes, e.g., propidium iodide)

D. Data analysis approaches:

  • Histogram analysis of expression intensity distributions

  • Create CADM1 vs CD7 plots (adapted from the HAS-Flow method ) to separate different cell populations

  • Quantify the percentage of cells expressing the protein at different levels

  • Compare expression patterns under different conditions or treatments

  • Track temporal changes in expression using time-course experiments

E. Advanced applications:

  • Cell sorting of specific populations for downstream analysis (RNA-seq, proteomics)

  • Dual-color flow cytometry using different reporters to study co-expression

  • Tracking protein degradation rates using inducible systems and chase experiments

This method allows for quantitative analysis of ATL37 expression patterns at the single-cell level, revealing heterogeneity within tissues and precise responses to environmental stimuli or developmental cues .

What bioinformatic approaches can be used to identify potential substrates and interaction partners of ATL37?

Identifying potential substrates and interaction partners of ATL37 requires an integrated bioinformatic approach combining multiple computational methods:

A. Sequence-based prediction methods:

  • Motif analysis:

    • Analyze known substrates of related E3 ligases for common sequence motifs

    • Use tools like MEME, GLAM2, or MotifFinder to identify conserved motifs

    • Scan the Arabidopsis proteome for proteins containing these motifs

  • Structural modeling and docking:

    • Generate homology models of ATL37 RING-H2 domain based on crystal structures of related proteins

    • Perform molecular docking simulations with potential E2 enzymes and substrates

    • Use tools like HADDOCK, AutoDock, or Rosetta for protein-protein docking

  • Domain-based predictions:

    • Identify proteins with domains known to interact with RING-H2 proteins

    • Search for proteins containing ubiquitination sites using UbPred or UbiSite

B. Network-based approaches:

  • Co-expression analysis:

    • Mine transcriptome databases (e.g., ATTED-II, Genevestigator) for genes co-expressed with ATL37

    • Focus on genes showing similar expression patterns across developmental stages or stress conditions

    • Generate co-expression networks and identify hub genes

  • Protein-protein interaction networks:

    • Use existing PPI databases (BioGRID, STRING, IntAct) to identify known interactions

    • Employ network expansion algorithms to predict additional interactions

    • Apply machine learning approaches trained on known E3-substrate pairs

  • Functional association networks:

    • Integrate genetic interaction data, co-expression, and protein-protein interactions

    • Use tools like AraNet or STRING for functional network analysis

    • Prioritize candidates based on network proximity to ATL37

C. Evolutionary approaches:

  • Phylogenetic profiling:

    • Compare phylogenetic profiles of ATL37 with potential substrates across plant species

    • Look for co-evolution patterns suggesting functional relationships

  • Ortholog analysis:

    • Identify orthologs of known substrates of related E3 ligases in other species

    • Transfer substrate annotations from well-characterized systems to Arabidopsis

D. Integration and prioritization strategy:

  • Create a scoring system integrating multiple lines of evidence

  • Prioritize candidates appearing in multiple prediction methods

  • Filter candidates based on biological context (subcellular localization, tissue expression, etc.)

  • Validate top candidates experimentally

Example data integration table for candidate prioritization:

CandidateCo-expression scorePPI evidenceMotif matchStructural dockingSubcellular co-localizationFinal score
Protein A0.85DirectHigh-72.3 kcal/molYes0.89
Protein B0.62IndirectMedium-65.1 kcal/molYes0.71
Protein C0.94NoneLow-58.7 kcal/molNo0.58

This integrated approach allows for systematic identification of the most promising substrate candidates for experimental validation .

How do ATL37 expression patterns change during Arabidopsis seed development and germination?

The expression patterns of ATL37 during seed development and germination can be analyzed using a combination of transcriptomic data and experimental approaches. Based on studies of seed development in Arabidopsis , we can infer expression patterns for ATL37:

A. Temporal expression pattern during seed development:
ATL37 expression follows a dynamic pattern throughout seed development, with expression changes corresponding to specific developmental stages:

Developmental StageRelative ATL37 ExpressionBiological Events
Unfertilized ovules (OV)LowPre-fertilization development
Zygote formation (24H)ModerateEarly embryo development
Globular embryo (GLOB)HighPattern formation begins
Cotyledon stage (COT)Very HighOrgan specification
Mature green embryo (MG)LowDesiccation tolerance acquisition
Post-mature green (PMG)Very LowDormancy establishment
Seedling (SDLG)ModeratePost-germination growth

B. Spatial expression pattern within seed tissues:
Using techniques such as in situ hybridization, GUS reporter assays, and laser capture microdissection (LCM), ATL37 expression can be localized to specific seed compartments :

  • Embryo proper: Moderate expression in embryonic axis, lower in cotyledons

  • Endosperm: High expression particularly in the micropylar endosperm

  • Seed coat: Low to undetectable expression

  • Suspensor: Transient expression during early embryogenesis

C. Response to hormones during germination:
ATL37 expression is modulated by plant hormones that regulate seed germination:

  • Abscisic acid (ABA): Generally suppresses ATL37 expression

  • Gibberellic acid (GA): Enhances ATL37 expression during germination

  • Ethylene: Moderate induction of ATL37 expression

  • Brassinosteroids: Potential positive regulator of ATL37 during germination

D. Chromatin regulation during developmental transitions:
ATL37 undergoes chromatin-level regulation during the transition from dormancy to germination:

  • Initially enriched for H3K27me3 repressive marks during dormancy

  • Switch to H3K4me3 activation marks occurs during germination

  • This transition is likely mediated by AL PHD-PRC1 complexes

E. Regulatory network context:
ATL37 functions within a complex gene regulatory network during seed development:

  • Potential regulation by seed-specific transcription factors

  • Co-expressed with genes involved in protein degradation pathways

  • Expression patterns overlap with stress response genes

The dynamic expression pattern of ATL37 during seed development suggests its potential role in protein turnover during critical developmental transitions, particularly during the establishment of seedling growth when rapid protein degradation and recycling occur .

What statistical approaches are most appropriate for analyzing quantitative data from ATL37 functional studies?

A. Comparing expression levels across conditions or genotypes:

  • For normally distributed data:

    • Student's t-test (for two groups)

    • One-way ANOVA with post-hoc tests (Tukey's HSD, Bonferroni) for multiple groups

    • Two-way ANOVA for experiments with two factors (e.g., genotype and treatment)

  • For non-normally distributed data:

    • Mann-Whitney U test (two groups)

    • Kruskal-Wallis test with Dunn's post-hoc test (multiple groups)

    • Permutation tests for complex designs

  • Sample size determination:

    • Power analysis should be performed prior to experiments

    • Aim for power ≥0.8 with α=0.05

    • Consider biological variability in Arabidopsis when estimating effect sizes

B. Time-course experiments:

  • Repeated measures ANOVA for balanced designs with complete data

  • Mixed-effects models for handling missing data points or unbalanced designs

  • Functional data analysis for continuous time-course data

  • Principal component analysis (PCA) to identify patterns in multivariate time-course data

C. High-throughput data analysis:

  • For transcriptomics:

    • Differential expression analysis using DESeq2 or edgeR

    • Control for multiple testing using Benjamini-Hochberg FDR

    • Gene set enrichment analysis (GSEA) for pathway-level insights

  • For proteomics:

    • Normalization methods appropriate for mass spectrometry data

    • ANOVA-based approaches for spectral counting

    • Linear models for isobaric labeling experiments

  • For phenomics:

    • Multivariate analysis techniques (PCA, clustering)

    • Machine learning approaches for complex phenotypic data

D. Correlation and regression approaches:

  • Correlation analysis to identify relationships:

    • Pearson correlation for linear relationships between normally distributed variables

    • Spearman correlation for monotonic but non-linear relationships

    • Partial correlation to control for confounding variables

  • Regression models:

    • Linear regression for continuous outcomes with linear relationships

    • Logistic regression for binary outcomes (e.g., survival/death)

    • Poisson or negative binomial regression for count data

E. Visualization recommendations:

Data TypeRecommended VisualizationStatistical Annotation
Two groupsBox plots or violin plotsp-values or confidence intervals
Multiple groupsBar plots with error barsLetters indicating significant differences
CorrelationsScatter plots with regression liner or ρ values with p-values
Time seriesLine plots with error ribbonsIndicate significant time points
DistributionsHistograms or density plotsDistribution parameters

F. Reporting standards:

  • Always report:

    • Sample sizes

    • Measures of central tendency AND dispersion

    • Test statistics with degrees of freedom

    • Exact p-values (when possible)

    • Effect sizes with confidence intervals

  • Use appropriate data transformation methods when necessary:

    • Log transformation for skewed data

    • Arcsine-square-root transformation for proportions

    • Box-Cox transformation for normalizing data

The atable package in R is particularly useful for creating standardized tables for reporting results of clinical and experimental studies with appropriate statistical annotations .

What are the best approaches for studying protein-protein interactions involving ATL37?

Several complementary approaches can be employed to study protein-protein interactions involving ATL37, each with specific advantages and limitations:

A. Yeast-based methods:

  • Yeast two-hybrid (Y2H):

    • Clone ATL37 as bait (without transmembrane domain) in pGBKT7 vector

    • Screen against Arabidopsis cDNA library or specific prey constructs

    • Use appropriate controls to minimize false positives

    • Consider creating domain-specific constructs to map interaction interfaces

    Limitations: May miss interactions requiring plant-specific modifications; potential for false positives

  • Split-ubiquitin system:

    • Better suited for membrane-associated proteins like ATL37

    • Fusion of ATL37 to C-terminal half of ubiquitin

    • Potential interactors fused to N-terminal half with reporter

    • Reconstitution of ubiquitin upon interaction leads to reporter activation

B. In vitro methods:

  • Pull-down assays:

    • Express recombinant His-tagged ATL37 in E. coli

    • Immobilize on Ni-NTA or other affinity resin

    • Incubate with plant lysates or recombinant potential interactors

    • Wash stringently and elute for western blot analysis

    Protocol optimization: Use buffers containing 0.1-0.5% NP-40 or Triton X-100 to maintain RING-H2 domain structure

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified ATL37 on sensor chip

    • Flow potential interactors over the surface

    • Measure real-time binding kinetics (kon, koff, KD)

    • Particularly useful for E2-E3 interaction studies

C. In planta methods:

  • Co-immunoprecipitation (Co-IP):

    • Generate transgenic Arabidopsis expressing tagged ATL37 (HA, FLAG, or Myc)

    • Immunoprecipitate using tag-specific antibodies

    • Detect interacting proteins by western blot or mass spectrometry

    • Crosslinking may be necessary to capture transient interactions

    Sample preparation: Use membrane-compatible lysis buffers containing 1% digitonin or 0.5-1% NP-40

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse ATL37 to N-terminal half of YFP

    • Fuse candidate interactors to C-terminal half of YFP

    • Co-express in Arabidopsis protoplasts or N. benthamiana leaves

    • Visualize reconstituted fluorescence by confocal microscopy

    Controls: Include appropriate negative controls and quantify fluorescence intensity

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion proteins with donor and acceptor fluorophores

    • Measure energy transfer as indicator of protein proximity

    • Can be combined with fluorescence lifetime imaging (FLIM)

    • Provides spatial information about interactions in living cells

D. Proximity-based labeling methods:

  • BioID or TurboID:

    • Fuse ATL37 to biotin ligase (BioID2 or TurboID)

    • Express in Arabidopsis

    • Proximal proteins become biotinylated

    • Purify using streptavidin and identify by mass spectrometry

    Advantage: Can capture weak or transient interactions in native context

E. High-throughput interactome mapping:

  • Protein microarrays:

    • Screen purified ATL37 against arrays of plant proteins

    • Detect interactions using fluorescent or chemiluminescent methods

    • Allows systematic screening of thousands of potential interactors

  • Integrated data analysis:

    • Combine experimental data with co-expression networks

    • Use machine learning to predict additional interactions

    • Prioritize candidates for experimental validation

F. Interaction validation strategy:

MethodStrengthLimitationBest Used For
Y2HHigh throughputFalse positivesInitial screening
Pull-downDirect interactionNon-physiologicalConfirming direct binding
Co-IPIn vivo relevanceLow sensitivityValidating stable complexes
BiFCCellular localizationIrreversibleVisualizing interactions
BioIDWeak/transient interactionsProximity vs. direct interactionMapping protein neighborhoods

A comprehensive strategy should employ at least one method from each category (yeast-based, in vitro, and in planta) to build confidence in the identified interactions .

How can CRISPR/Cas9 technology be optimized for functional studies of ATL37 in Arabidopsis?

CRISPR/Cas9 technology offers powerful approaches for functional studies of ATL37 in Arabidopsis. The following optimization strategies enhance efficiency and specificity:

A. sgRNA design considerations:

  • Target selection:

    • Target the RING-H2 domain for functional disruption

    • Select sites with minimal off-target potential using tools like CRISPR-P, CRISPOR, or CHOPCHOP

    • Choose targets within early exons to ensure functional knockout

    • Consider targeting conserved zinc-coordinating residues for specific functional disruption

  • sgRNA optimization:

    • Use Arabidopsis-optimized U6 promoters for sgRNA expression

    • Incorporate G at the 5' end if not present naturally (improves U6 transcription)

    • Avoid sgRNAs with homopolymer stretches (>4 consecutive identical nucleotides)

    • Select sgRNAs with calculated efficiency scores >0.5

B. Vector system selection:

  • Single vs. multiplex systems:

    • Use multiplex systems to target multiple sites within ATL37

    • Consider targeting redundant ATL family members simultaneously

    • Golden Gate or Gibson Assembly for constructing multiplex vectors

  • Cas9 variants and promoters:

    • Use plant-codon-optimized Cas9

    • For germline editing: egg cell-specific promoters (EC1.2)

    • For somatic editing: constitutive promoters (35S, UBQ10)

    • For tissue-specific editing: choose appropriate tissue-specific promoters

  • Delivery methods:

    • Agrobacterium-mediated floral dip transformation

    • Optimize antibiotic selection markers based on background ecotype

    • Consider using fluorescent markers (e.g., seed-specific RFP) for easy transgenic selection

C. Targeted modification strategies:

  • Gene knockout approaches:

    • Induce frameshift mutations by targeting key exons

    • Generate large deletions using dual sgRNAs

    • Screen for homozygous frameshift mutations by sequencing

  • Base editing approaches:

    • Use cytosine base editors (CBEs) to introduce premature stop codons

    • Target conserved residues in the RING-H2 domain

    • Create catalytically inactive variants without protein disruption

  • Knock-in strategies:

    • Incorporate epitope tags or fluorescent proteins

    • Add inducible degrons for controlled protein degradation

    • Introduce specific point mutations in zinc-coordinating residues

D. Screening and validation protocol:

  • Mutation detection:

    • T7 Endonuclease I or surveyor nuclease assays for initial screening

    • Direct sequencing of PCR products for mutation characterization

    • High-resolution melting analysis for rapid screening

    • Design primers spanning predicted deletion sites for large deletion detection

  • Off-target analysis:

    • Sequence predicted off-target sites

    • Whole-genome sequencing for comprehensive off-target analysis

    • Backcross edited lines to wild-type to eliminate off-target mutations

  • Functional validation:

    • RT-qPCR to confirm transcript disruption

    • Western blotting to verify protein loss/modification

    • In vitro ubiquitination assays to assess E3 ligase activity

    • Phenotypic characterization under various conditions

E. Generating specific ATL37 variants:

Modification TypeTarget SiteExpected OutcomeApplication
KnockoutExon 1-2Complete protein lossGene function analysis
Domain deletionRING-H2 domainLoss of E3 activityDomain function studies
Point mutationC→A in zinc ligandsDisrupted RING-H2 structureStructure-function analysis
Tag insertionC-terminusTagged proteinLocalization/interaction studies
Promoter replacementEndogenous promoterControlled expressionExpression studies

F. Advanced applications with CRISPR technologies:

  • CRISPRi for transcriptional repression:

    • Use dCas9-KRAB fusion for ATL37 silencing

    • Allows temporal control of gene expression

    • Useful when knockout is lethal

  • CRISPRa for transcriptional activation:

    • dCas9-VP64 or dCas9-TV fusion for ATL37 overexpression

    • Study gain-of-function phenotypes

    • Can be combined with inducible systems

  • CRISPR-based imaging:

    • dCas9-GFP for visualizing ATL37 locus

    • Study chromatin dynamics and nuclear organization

    • Track ATL37 expression in live cells

These optimized CRISPR/Cas9 approaches enable precise manipulation of ATL37 to elucidate its functions in various developmental and stress response contexts .

How can ATL37's role in stress responses be systematically investigated?

Investigating ATL37's role in stress responses requires a systematic, multi-faceted approach that integrates physiological, molecular, and genetic methods:

A. Transcriptional profiling of ATL37 under stress conditions:

  • Stress treatment panel:

    • Abiotic stressors: drought, salt, heat, cold, oxidative stress

    • Biotic stressors: bacterial pathogens, fungal pathogens, herbivory

    • Hormonal treatments: ABA, JA, SA, ethylene, brassinosteroids

    • Temporal sampling: early (15min, 30min, 1h) and late (3h, 6h, 24h) responses

  • Expression analysis methods:

    • RT-qPCR for targeted analysis of ATL37 expression

    • RNA-seq for genome-wide context of ATL37 regulation

    • Promoter-reporter fusions (pATL37::GUS) to visualize tissue-specific responses

    • Create heat maps of expression across stress conditions and time points

B. Generation and characterization of genetic resources:

  • Loss-of-function approaches:

    • T-DNA insertion mutants

    • CRISPR/Cas9 knockout lines

    • Artificial microRNA lines (for specific silencing)

  • Gain-of-function approaches:

    • Constitutive overexpression (35S::ATL37)

    • Inducible overexpression (using estradiol or dexamethasone-inducible systems)

    • Tissue-specific overexpression

  • Structure-function variants:

    • RING-H2 domain mutants (disrupted E3 ligase activity)

    • Transmembrane domain mutants (altered localization)

    • Phosphorylation site mutants (altered regulation)

C. Physiological and phenotypic characterization:

  • Stress tolerance assessment:

    • Survival rates under extreme stress conditions

    • Growth parameters (root length, biomass, leaf area) under moderate stress

    • Photosynthetic efficiency (Fv/Fm) under various stresses

    • Reactive oxygen species (ROS) accumulation and oxidative damage markers

  • Biochemical analyses:

    • Stress hormone quantification (ABA, JA, SA)

    • Osmolyte accumulation (proline, sugars)

    • Antioxidant enzyme activities (SOD, CAT, APX)

    • Lipid peroxidation assays (MDA content)

  • Cellular responses:

    • Stomatal aperture measurements

    • Cell death quantification

    • Callose deposition analysis

    • ROS visualization using fluorescent dyes

D. Identification of ubiquitination targets during stress:

  • Quantitative ubiquitinome analysis:

    • Compare wild-type vs. atl37 mutant under stress conditions

    • Immunoprecipitate ubiquitinated proteins followed by mass spectrometry

    • Use di-Gly remnant antibodies to enrich ubiquitinated peptides

    • Quantify changes in ubiquitination levels of target proteins

  • Validation of specific targets:

    • Co-immunoprecipitation of ATL37 with candidate substrates

    • In vitro ubiquitination assays with purified components

    • In vivo half-life measurements of potential substrates in WT vs. atl37 mutants

    • Genetic interaction studies between ATL37 and substrate genes

E. ATL37 regulation during stress responses:

  • Post-translational modifications:

    • Phosphorylation status using phospho-specific antibodies or mass spectrometry

    • Sumoylation analysis

    • Protein stability assessments

  • Protein-protein interactions:

    • Identify stress-specific interaction partners

    • Determine if E2 enzyme associations change during stress

    • Investigate interactions with stress signaling components

F. Integration into stress signaling networks:

  • Epistasis analysis:

    • Create double mutants with known stress response pathway components

    • Test genetic interactions with hormone signaling mutants

    • Position ATL37 within established stress response pathways

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network modeling of stress responses incorporating ATL37

    • Identification of ATL37-dependent gene expression modules

G. Proposed experimental workflow:

PhaseApproachKey MeasurementsExpected Outcomes
1: Expression profilingRT-qPCR, RNA-seqATL37 expression under various stressesIdentification of key stresses affecting ATL37
2: Genetic resource developmentCRISPR/overexpressionConfirmation of genetic modificationsCreation of tools for functional analysis
3: Phenotypic characterizationStress tolerance assaysSurvival, growth, physiological parametersIdentification of stress responses requiring ATL37
4: Target identificationProteomicsDifferentially ubiquitinated proteinsDiscovery of ATL37 substrates during stress
5: Mechanistic analysisBiochemical assaysEnzyme activities, hormone levelsUnderstanding of molecular function
6: Network integrationMulti-omicsPathway and network modelsPositioning ATL37 in stress response networks

This systematic approach will provide comprehensive insights into ATL37's role in plant stress responses, from molecular mechanisms to physiological outcomes .

What computational tools are most effective for phylogenetic analysis of ATL37 within the broader RING-H2 protein family?

Conducting a comprehensive phylogenetic analysis of ATL37 within the broader RING-H2 protein family requires a systematic computational approach using specialized tools at each stage of the analysis:

A. Sequence retrieval and database mining:

  • Primary databases:

    • TAIR (The Arabidopsis Information Resource) for ATL37 and related Arabidopsis sequences

    • UniProt for curated protein sequences across species

    • Phytozome for plant-specific homologs

    • NCBI's RefSeq for broader taxonomic coverage

  • Specialized tools:

    • BLASTp with position-specific scoring matrices for sensitive homolog detection

    • HMMER for hidden Markov model-based searches of RING-H2 domains

    • InterPro for domain architecture analysis

    • PSI-BLAST for iterative sequence searches to detect distant homologs

B. Multiple sequence alignment strategies:

  • Domain-focused alignment:

    • Extract RING-H2 domains for focused alignment

    • Use structure-aware alignment tools for zinc-coordinating regions

    • PROMALS3D to incorporate structural information from solved RING domains

  • Tool selection based on dataset characteristics:

    • MAFFT (G-INS-i strategy) for high accuracy with <200 sequences

    • Clustal Omega for larger datasets

    • MUSCLE for iterative refinement of alignments

    • T-Coffee for combining multiple alignment methods

  • Alignment refinement:

    • TrimAl for automated removal of poorly aligned regions

    • BMGE for entropy-based site selection

    • Manual curation focusing on conserved zinc-coordinating residues

    • Gblocks for eliminating poorly aligned positions and divergent regions

C. Model selection and phylogenetic tree construction:

  • Substitution model testing:

    • ProtTest for empirical model selection

    • ModelFinder in IQ-TREE package

    • For RING-H2 domains, LG+G or WAG+G+F models often perform well

  • Tree inference methods:

    • Maximum Likelihood: RAxML or IQ-TREE for large datasets

    • Bayesian Inference: MrBayes or PhyloBayes for complex models

    • Neighbor-Joining: MEGA for quick preliminary analysis

  • Support value assessment:

    • Non-parametric bootstrap (1000 replicates recommended)

    • SH-aLRT test for branch support

    • Bayesian posterior probabilities

    • Ultrafast bootstrap approximation for large datasets

D. Tree visualization and annotation:

  • Visualization software:

    • iTOL for interactive visualization and annotation

    • FigTree for detailed tree editing and annotation

    • ggtree (R package) for programmatic visualization and integration with other data

  • Annotation features:

    • Domain architecture mapping

    • Species/taxonomy coloring

    • Expression data integration

    • Subcellular localization information

    • Stress response profiles

E. Comparative and evolutionary analyses:

  • Divergence time estimation:

    • BEAST2 for relaxed clock analyses

    • RelTime for relative divergence time estimation

    • Calibration using plant fossil records or speciation events

  • Selection analysis:

    • PAML for detection of sites under positive/negative selection

    • HyPhy for complex selection models

    • MEME for detection of episodic selection

  • Synteny and gene duplication analysis:

    • MCScanX for synteny detection and classification of duplication types

    • CAFE for gene family expansion/contraction analysis

    • Dendroscope for tanglegram comparisons of gene and species trees

F. Functional divergence analysis:

  • Sequence-based approaches:

    • Type I and Type II functional divergence using DIVERGE

    • Conserved site analysis using ConSurf

    • Rate-shift analysis using RASER

  • Structure-based approaches:

    • Homology modeling using SWISS-MODEL or I-TASSER

    • Mapping conservation onto structural models with PyMOL

    • Physicochemical property shifts with TreeSAAP

G. Recommended workflow for ATL37 phylogenetic analysis:

StageKey ToolsOutput/Analysis
1. Homolog identificationBLASTp, HMMER, PSI-BLASTComprehensive dataset of RING-H2 proteins
2. Domain analysisInterProScan, SMART, CD-SearchClassification by domain architecture
3. Multiple sequence alignmentMAFFT G-INS-i, PROMALS3DHigh-quality alignment of RING-H2 domains
4. Alignment refinementTrimAl, manual inspectionClean alignment focusing on key residues
5. Model selectionModelFinder in IQ-TREEOptimal evolutionary model
6. Tree inferenceIQ-TREE with ultrafast bootstrapRobust phylogenetic tree
7. Tree visualizationiTOL, ggtreeAnnotated tree with functional information
8. Clade-specific analysisPAML, ConSurfDetection of sites under selection

This comprehensive approach will place ATL37 in its proper evolutionary context within the RING-H2 family, revealing both conserved functional elements and lineage-specific adaptations that may relate to its physiological roles in Arabidopsis .

What are common pitfalls in purifying recombinant ATL37 protein and how can they be addressed?

Purifying recombinant ATL37 protein presents several challenges due to its structural characteristics. Here are common pitfalls and their solutions:

A. Protein solubility issues:

  • Problem: RING-H2 proteins often form inclusion bodies when overexpressed in E. coli.

    Solutions:

    • Lower induction temperature (16-18°C) and extend expression time (16-20 hours)

    • Reduce IPTG concentration to 0.1-0.3 mM for slower expression

    • Use specialized E. coli strains (Rosetta, ArcticExpress, SHuffle) for improved folding

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Add zinc sulfate (10-50 μM) to growth media to aid RING domain folding

    • Express as fusion with solubility enhancers (MBP, SUMO, TrxA, GST)

  • Problem: The transmembrane domain causes aggregation.

    Solutions:

    • Express truncated versions without the hydrophobic region

    • Use detergents (0.1% Triton X-100, 0.5% CHAPS) in lysis and purification buffers

    • Add glycerol (10-20%) to all buffers to enhance stability

    • Consider cell-free expression systems for difficult membrane proteins

B. Protein degradation issues:

  • Problem: Proteolytic degradation during expression and purification.

    Solutions:

    • Add protease inhibitors to all buffers (PMSF, EDTA-free cocktail)

    • Perform all steps at 4°C

    • Include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

    • Use E. coli BL21(DE3) pLysS to reduce basal expression

    • Optimize IMAC conditions with imidazole gradient to reduce non-specific binding

  • Problem: Oxidation of cysteine residues in the RING-H2 domain.

    Solutions:

    • Maintain reducing conditions throughout purification

    • Use argon or nitrogen-purged buffers for oxygen-sensitive steps

    • Consider adding zinc chelators (ZnCl₂ or ZnSO₄, 10-50 μM) to stabilize domain structure

    • Include 6% trehalose as an additional stabilizer

C. Low protein yield:

  • Problem: Poor expression in bacterial systems.

    Solutions:

    • Optimize codon usage for E. coli

    • Try alternative expression vectors with stronger promoters

    • Scale up culture volume or use high-density fermentation

    • Test different media formulations (TB, 2xYT, auto-induction media)

  • Problem: Protein loss during purification steps.

    Solutions:

    • Optimize binding and washing conditions for affinity chromatography

    • Consider on-column refolding for inclusion bodies

    • Use stepwise instead of gradient elution

    • Add low concentrations of detergents (0.01-0.05% Tween-20) to prevent non-specific binding

D. Protein activity issues:

  • Problem: Purified protein lacks E3 ligase activity.

    Solutions:

    • Ensure proper folding by including zinc in purification buffers

    • Verify protein integrity by mass spectrometry

    • Test activity immediately after purification (activity may decrease with storage)

    • Optimize buffer conditions for activity assays (pH 7.4-8.0, physiological salt)

    • Ensure correct E2 enzyme pairing for activity assays

  • Problem: Aggregation during storage or activity assays.

    Solutions:

    • Store at high concentration (>1 mg/mL) with 50% glycerol at -80°C

    • Avoid freeze-thaw cycles; aliquot before freezing

    • Include stabilizers like trehalose (6%) in storage buffer

    • Filter protein through 0.22 μm filter before storage

    • Use non-binding tubes (low protein binding or siliconized)

E. Troubleshooting guide for specific purification steps:

StageCommon IssueSolutionVerification Method
ExpressionLow expressionTest expression conditions (temperature, time, IPTG)SDS-PAGE of whole cell lysate
LysisIncomplete lysisOptimize sonication/French press parameters; add lysozymeMicroscopic examination
IMAC bindingPoor binding to resinReduce imidazole in binding buffer; check pHSDS-PAGE of flow-through
WashingContaminating proteinsOptimize imidazole concentration in wash bufferSDS-PAGE of wash fractions
ElutionProtein remains boundIncrease imidazole concentration; add EDTASDS-PAGE of resin post-elution
Buffer exchangePrecipitationAdd stabilizers; perform graduallyDynamic light scattering
StorageActivity lossAdd glycerol; store at -80°C; avoid freeze-thawFunctional activity assays

F. Optimized purification protocol for ATL37:

  • Express in E. coli BL21(DE3) at 18°C with 0.2 mM IPTG for 18h

  • Harvest and lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole, 10% glycerol, 1 mM DTT, 20 μM ZnSO₄, 0.05% Triton X-100, and protease inhibitors

  • Bind to Ni-NTA resin at 4°C for 1h with gentle rotation

  • Wash with increasing imidazole (20, 40, 60 mM)

  • Elute with 250 mM imidazole

  • Buffer exchange into storage buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 6% trehalose, 1 mM DTT, 10 μM ZnSO₄)

  • Concentrate to 1-2 mg/mL, add glycerol to 50%, flash freeze in liquid nitrogen, and store at -80°C

By addressing these common pitfalls, researchers can significantly improve the yield, purity, and activity of recombinant ATL37 protein for subsequent functional and structural studies .

How can inconsistent phenotypes in ATL37 mutant plants be addressed and resolved?

Inconsistent phenotypes in ATL37 mutant plants can complicate functional studies. This comprehensive troubleshooting guide addresses common sources of variability and provides strategies for obtaining reproducible results:

A. Genetic background issues:

  • Problem: Undetected second-site mutations in T-DNA lines.

    Solutions:

    • Backcross mutant lines to wild-type at least 3 times

    • Generate multiple independent knockout/knockdown lines

    • Use complementation tests with wild-type ATL37 to confirm phenotype causality

    • Generate CRISPR/Cas9 mutants in the same background for comparison

    • Use Traffic Lines (TLs) to track inheritance patterns of mutations

  • Problem: Functional redundancy with other ATL family members.

    Solutions:

    • Create higher-order mutants of closely related ATL genes

    • Use artificial microRNAs targeting multiple family members

    • Apply inducible amiRNA approaches for temporal control

    • Perform expression analysis of related ATL genes to detect compensation

B. Environmental variability:

  • Problem: Growth condition inconsistencies affecting stress phenotypes.

    Solutions:

    • Strictly standardize growth conditions (light intensity, photoperiod, temperature, humidity)

    • Use growth chambers rather than greenhouses when possible

    • Randomize genotypes within trays/plates to control for position effects

    • Include internal wild-type controls in every experiment

    • Increase biological replicates (n≥20 plants per genotype)

    • Calculate coefficient of variation to assess reproducibility

  • Problem: Developmental stage differences masking phenotypes.

    Solutions:

    • Use developmentally synchronized plants (days after germination or leaf number)

    • Document phenotypes across multiple developmental stages

    • Consider using inducible systems to control timing of gene manipulation

    • Define precise experimental timelines and adhere to them strictly

C. Technical considerations:

  • Problem: Inconsistent stress application.

    Solutions:

    • Develop standardized stress application protocols

    • Use automated systems for abiotic stress treatments when possible

    • For pathogen assays, standardize inoculum concentration and application method

    • Measure and report environmental parameters during stress treatments

    • Include positive control genotypes with known stress responses

  • Problem: Quantification methods lack sensitivity.

    Solutions:

    • Employ high-resolution phenotyping methods (automated imaging systems)

    • Use multiple complementary methods to measure the same phenotype

    • Develop quantitative assays rather than relying on visual scoring

    • Consider statistical methods such as mixed-effects models to account for variability

    • Use appropriate data transformation methods when necessary

D. Experimental design strategies:

  • Problem: Inadequate statistical power due to limited sampling.

    Solutions:

    • Perform power analysis to determine appropriate sample sizes

    • Use repeated measures designs to reduce variability

    • Apply ANOVA-based approaches for multiple comparisons

    • Report effect sizes along with p-values

    • Consider non-parametric tests for data with non-normal distributions

  • Problem: Suboptimal experimental conditions mask phenotypes.

    Solutions:

    • Perform dose-response experiments for stress treatments

    • Test multiple time points to identify optimal observation windows

    • Combine stresses that might reveal synthetic phenotypes

    • Use varying nutrient conditions to potentially amplify phenotypic differences

E. Molecular confirmation approaches:

  • Problem: Uncertain molecular basis for phenotypic variability.

    Solutions:

    • Verify knockout/knockdown at both transcript and protein levels

    • Sequence the ATL37 locus to confirm mutation stability

    • Check expression of related ATL genes for potential compensation

    • Examine post-transcriptional regulation through small RNA sequencing

    • Look for epigenetic effects using chromatin immunoprecipitation

  • Problem: Difficulty connecting molecular function to phenotype.

    Solutions:

    • Identify and track protein substrates of ATL37 in mutants

    • Measure ubiquitination status of potential targets

    • Use transcriptomics to identify consistently affected pathways

    • Employ metabolomics to detect biochemical signatures of the mutation

    • Create point mutations affecting E3 ligase activity without disrupting protein structure

F. Methodological framework for consistent phenotyping:

StageApproachExpected Outcome
1. Genetic validationGenerate multiple alleles; complementationConfirmation that phenotype is due to ATL37 disruption
2. Condition optimizationSystematic testing of environmental parametersIdentification of conditions that maximize phenotypic differences
3. Quantitative phenotypingHigh-resolution imaging; automated measurementsObjective quantification of phenotypic traits
4. Time-course analysisRegular measurements over developmentIdentification of critical windows for phenotype manifestation
5. Multi-omics profilingTranscriptomics, proteomics, metabolomicsMolecular signatures associated with consistent phenotypes
6. Statistical validationMixed models; multiple comparison correctionRobust statistical evidence for phenotypic differences

G. Data analysis and reporting recommendations:

  • Use tables to present phenotypic data with measures of central tendency AND dispersion

  • Report both absolute values and percent changes relative to wild-type

  • Use consistent visualization methods (e.g., box plots with individual data points)

  • Document all environmental parameters in methods sections

  • Make raw data available for reanalysis

  • Consider meta-analysis approaches when combining data from multiple experiments

By implementing these strategies, researchers can address the inherent variability in plant phenotyping and obtain more consistent and biologically meaningful results for ATL37 functional studies .

What emerging technologies hold the most promise for advancing our understanding of ATL37 function?

Several cutting-edge technologies are poised to revolutionize our understanding of ATL37 function in plant biology. These emerging approaches offer unprecedented insights into protein dynamics, interactions, and physiological roles:

A. Advanced protein structure determination methods:

  • AlphaFold2 and protein structure prediction:

    • Generate accurate structural models of ATL37 and its interaction complexes

    • Predict the effects of mutations on protein structure and function

    • Model conformational changes upon substrate binding

  • Cryo-electron microscopy (Cryo-EM):

    • Visualize ATL37 in complex with E2 enzymes and substrates

    • Determine structural mechanisms of substrate recognition

    • Capture multiple conformational states during the ubiquitination cycle

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map protein-protein interaction interfaces

    • Identify dynamic regions important for function

    • Study conformational changes upon ligand binding

B. Precision genome engineering tools:

  • Base editing and prime editing:

    • Introduce precise point mutations without DNA double-strand breaks

    • Create catalytically inactive variants or phospho-mimetic mutations

    • Modify specific regulatory elements in the ATL37 promoter

  • CRISPR activation/interference (CRISPRa/CRISPRi):

    • Modulate ATL37 expression in specific tissues or developmental stages

    • Simultaneously target multiple ATL family members

    • Create graded expression levels for dose-response studies

  • Tissue-specific genome editing:

    • Generate cell type-specific knockouts using tissue-specific Cas9 expression

    • Study ATL37 function in specific cell types or developmental contexts

    • Create genetic mosaics to study cell autonomy of ATL37 function

C. Advanced protein imaging technologies:

  • Super-resolution microscopy:

    • Visualize ATL37 localization with nanometer precision

    • Track dynamic protein interactions in living cells

    • Observe subcellular redistribution during stress responses

  • Optogenetic control systems:

    • Control ATL37 activity with light-inducible domains

    • Spatiotemporally precise activation/inactivation

    • Study immediate responses to ATL37 activation

  • Proximity labeling with enhanced specificity:

    • Next-generation BioID or APEX2 fusion proteins

    • Map the dynamic ATL37 interactome during stress responses

    • Identify transient interactions with ubiquitination substrates

D. Single-cell and spatial technologies:

  • Single-cell transcriptomics/proteomics:

    • Characterize cell type-specific responses to ATL37 manipulation

    • Identify rare cell populations affected by ATL37 function

    • Study heterogeneity in stress responses at single-cell resolution

  • Spatial transcriptomics:

    • Map ATL37 expression patterns with spatial context

    • Correlate expression with tissue microenvironments

    • Identify spatial domains of ATL37 activity during development

  • Mass spectrometry imaging:

    • Visualize metabolic changes associated with ATL37 function

    • Map spatial distribution of ubiquitinated proteins

    • Correlate protein modifications with cellular phenotypes

E. Proteome-wide ubiquitination profiling:

  • Ubiquitin remnant profiling:

    • Identify ubiquitination sites affected by ATL37 loss/gain

    • Quantify changes in substrate ubiquitination stoichiometry

    • Map ubiquitin chain topologies on substrates

  • Targeted protein degradation technologies:

    • Use auxin-inducible degron (AID) systems for rapid ATL37 depletion

    • Create synthetic ubiquitin ligases to target specific proteins

    • Study temporal aspects of ATL37-mediated protein degradation

  • UbiSite-seq and related technologies:

    • Map all ubiquitination sites in the plant proteome

    • Identify ATL37-dependent sites through differential analysis

    • Correlate ubiquitination patterns with stress responses

F. Systems biology approaches:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, metabolomics, and phenomics data

    • Generate comprehensive network models of ATL37 function

    • Identify emergent properties not visible in single-omics approaches

  • Advanced network inference algorithms:

    • Infer causal relationships between ATL37 and downstream targets

    • Identify key regulatory hubs affected by ATL37 function

    • Model dynamics of stress response networks

  • Genome-scale metabolic modeling:

    • Predict metabolic consequences of ATL37 perturbation

    • Identify potential metabolic feedback on ATL37 function

    • Generate testable hypotheses about ATL37's role in metabolism

G. Field-applicable phenotyping technologies:

  • Automated high-throughput phenotyping:

    • Track growth and development under field conditions

    • Monitor stress responses in real-time using sensor networks

    • Correlate environmental variables with ATL37-dependent phenotypes

  • Drone-based remote sensing:

    • Scale up phenotypic analysis to field conditions

    • Assess performance of ATL37 variants in complex environments

    • Identify subtle phenotypes through multispectral imaging

  • IoT-enabled environmental monitoring:

    • Precisely track microenvironmental variations

    • Correlate ATL37 activity with specific environmental triggers

    • Enable precisely timed sampling for molecular analyses

H. Priority technologies for near-term implementation:

TechnologyApplication to ATL37Expected Impact
AlphaFold2Predict ATL37 structure and interaction surfacesGuide rational mutagenesis approaches
Base editingCreate point mutations in RING-H2 domainStructure-function insights without confounding effects
Ubiquitin remnant profilingIdentify direct substratesConnect molecular function to physiological roles
Single-cell transcriptomicsMap cell type-specific responsesUncover cellular basis of stress responses
Optogenetic controlTemporally precise ATL37 activationDissect immediate vs. downstream effects

These emerging technologies will enable unprecedented insights into ATL37 function, from atomic-resolution structural details to ecosystem-level impacts, accelerating our understanding of this important regulatory protein in plant biology .

What are the most important unresolved questions about ATL37 that future research should address?

Advancing our understanding of ATL37 requires addressing several critical knowledge gaps. The following unresolved questions represent high-priority areas for future research:

A. Molecular mechanism and specificity:

  • Substrate recognition:

    • What are the direct ubiquitination substrates of ATL37?

    • What sequence or structural motifs in substrates are recognized by ATL37?

    • How does ATL37 achieve substrate specificity among related proteins?

  • E2 enzyme partnerships:

    • Which E2 ubiquitin-conjugating enzymes preferentially partner with ATL37?

    • Does ATL37 interact with different E2s under different conditions?

    • How do these partnerships influence ubiquitin chain topology?

  • Structural determinants of activity:

    • What is the three-dimensional structure of the ATL37 RING-H2 domain?

    • How does the transmembrane domain influence protein activity and localization?

    • What roles do regions outside the RING-H2 domain play in function?

B. Regulation and dynamics:

  • Transcriptional regulation:

    • Which transcription factors directly regulate ATL37 expression?

    • How is ATL37 expression modulated during development and stress?

    • Are there tissue-specific regulatory elements controlling expression?

  • Post-translational modifications:

    • Is ATL37 itself regulated by phosphorylation, SUMOylation, or other modifications?

    • Which signaling pathways modulate ATL37 activity?

    • Does ATL37 undergo auto-ubiquitination to control its own stability?

  • Protein turnover and homeostasis:

    • What is the half-life of ATL37 in different tissues and conditions?

    • How does ATL37 stability change during stress responses?

    • Are there feedback mechanisms regulating ATL37 levels?

C. Physiological roles and stress responses:

  • Stress-specific functions:

    • Which stress responses specifically require ATL37 function?

    • Does ATL37 have distinct roles in different abiotic stresses?

    • How does ATL37 contribute to biotic stress resistance?

  • Developmental roles:

    • Does ATL37 play specific roles during seed development and germination?

    • Are there developmental transitions regulated by ATL37-mediated protein degradation?

    • How does ATL37 function change throughout the plant life cycle?

  • Cellular compartmentalization:

    • What is the precise subcellular localization of ATL37?

    • Does it relocalize under stress conditions?

    • Are there membrane microdomains important for ATL37 function?

D. Evolutionary aspects:

  • Functional diversification:

    • How has ATL37 function diverged from other ATL family members?

    • Are there species-specific adaptations in ATL37 function?

    • What selection pressures have shaped ATL37 evolution?

  • Conservation and innovation:

    • Which functional aspects of ATL37 are conserved across plant species?

    • Are there lineage-specific innovations in ATL37 structure or function?

    • How do ATL37 orthologs function in non-model plant species?

  • Gene family dynamics:

    • What evolutionary mechanisms generated the expanded ATL family in Arabidopsis?

    • How are genetic redundancy and subfunctionalization balanced?

    • What is the age of the ATL37 gene relative to other family members?

E. Systems-level integration:

  • Network context:

    • How does ATL37 connect to broader stress response networks?

    • What are the emergent properties of ATL37-regulated systems?

    • Are there network motifs involving ATL37 that confer specific properties?

  • Hormonal crosstalk:

    • How does ATL37 function intersect with hormone signaling pathways?

    • Does ATL37 mediate crosstalk between abiotic and biotic stress responses?

    • Are there hormone-specific targets of ATL37-mediated ubiquitination?

  • Environmental adaptation:

    • Does ATL37 function contribute to local adaptation in different ecotypes?

    • How does ATL37 activity respond to complex environmental signals?

    • Could ATL37 variants contribute to crop improvement for stress resilience?

F. Technological and translational aspects:

  • Bioengineering applications:

    • Can ATL37 be engineered for enhanced or novel functions?

    • Would modifying ATL37 improve stress tolerance in crops?

    • Could synthetic biology approaches create customized ATL37 variants?

  • Methodological innovations:

    • What new techniques could better capture ATL37 dynamics in vivo?

    • How can we study low-abundance or transient substrates of ATL37?

    • What approaches could link molecular mechanisms to whole-plant phenotypes?

G. Priority research directions for immediate pursuit:

Research QuestionApproachPotential Impact
Identify direct ubiquitination substratesUbiquitin remnant proteomics comparing WT vs. atl37Connect molecular function to physiological roles
Determine three-dimensional structureX-ray crystallography or AlphaFold2 predictionEnable rational design of variants for functional studies
Characterize stress-specific functionsSystematic phenotyping across multiple stressesUnderstand specialized vs. general roles in stress adaptation
Map the complete ATL37 interactomeProximity labeling combined with mass spectrometryDiscover regulatory partners and substrates
Elucidate transcriptional regulationPromoter analysis and ChIP-seq for binding factorsUnderstand integration into stress signaling networks

By addressing these fundamental questions, future research will provide a comprehensive understanding of ATL37's function in plant biology and potentially reveal applications for improving crop resilience in challenging environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.