Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL53 (ATL53)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its inclusion in the production process.
Synonyms
ATL53; At4g17905; T6K21.90; Putative RING-H2 finger protein ATL53; RING-type E3 ubiquitin transferase ATL53
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL53
Target Protein Sequence
MESDPNPSAWNQYINPRDCTQGLCSTFCPQWCTYINFSPPPISYEQFLNDGVASNPNLSP LVIAIFGIFATAFLLAAYYTLVSKYCANDTTNEAASESGRSDIILDVNSPERGDQDDPFA LESSTAGLDDTLIKKIGFFKLKKHQNGFKINGTDCSICLGEFNEDESLRLLPKCNHTFHV VCIDRWLKSHSNCPLCRAKIIVPTTQQPEHHVVVMNLDRFTSNVGSAEGNVVVDDHREEV SVSISSHHPSWFSAADIVLRISRDGEEEEGNYDLENGNREKLVDLKRSFSSGGLVLGTQG RTRRSLNICP
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ATL gene family, and how is ATL53 classified within it?

The ATL gene family represents a novel family of Arabidopsis genes encoding a variant of the RING zinc finger domain known as RING-H2. Initially characterized with fifteen member sequences, the ATL family proteins typically contain two key domains: a RING-H2 domain and a transmembrane domain predominantly located toward the N-terminal end . ATL53 (At4g17905) belongs to this family and functions as an E3 ubiquitin ligase .

Phylogenetic analysis has expanded our understanding of this family, with comprehensive genome-wide studies identifying 1815 ATL members across 24 plant genomes. These have been classified into 9 distinct groups based on phylogenetic relationships and motif organization. Each ATL protein contains the canonical RING-H2 domain with six cysteines and two histidines that coordinate zinc ligation with precise spacing, plus a conserved tryptophan residue located three residues downstream from the sixth zinc ligand .

What are the common structural features shared among ATL family proteins?

ATL family proteins share several conserved structural elements:

  • RING-H2 Domain: All members contain this specialized zinc finger variant that coordinates two zinc atoms through a specific arrangement of cysteine and histidine residues. This domain is critical for E3 ubiquitin ligase activity .

  • Hydrophobic Region: Most ATLs contain a region rich in hydrophobic amino acids that functions as a transmembrane domain. While most family members have a single hydrophobic region, some lineages contain two or three such regions .

  • GLD Motif: Named after the conserved glycine, leucine, and aspartic acid residues, this 12-16 amino acid motif is located between the transmembrane helices and the RING-H2 domain. Its precise function remains unknown, though it appears essential to ATL protein function .

  • Domain Architecture: Comprehensive analysis has established 7 distinct regions in ATL proteins, with the three regions above (regions VI, II, and IV respectively) being the most conserved .

How does the RING-H2 domain in ATL53 contribute to its E3 ubiquitin ligase function?

The RING-H2 domain in ATL53, like other ATL family members, plays a crucial role in its E3 ubiquitin ligase function by mediating the interaction with E2 ubiquitin-conjugating enzymes. This interaction is essential for the transfer of ubiquitin to target proteins.

Structural studies of related ATL proteins have elucidated the mechanism of this interaction. For instance, NMR spectroscopy of the rice ATL protein EL5 revealed that its RING-H2 finger domain maintains the same structural features as previously characterized RING domains. Mutagenesis studies identified key amino acid residues within the RING-H2 domain critical for binding to E2 conjugases. These studies demonstrated a strong correlation between E3 activity and the degree of interaction between the E2 enzyme and various RING domain mutants .

Most ATL proteins interact with members of the Ubc4/Ubc5 subfamily of E2 conjugases. Additional regions within ATL proteins, such as the arginine-rich motif in region III, may also contribute to E2 binding through electrostatic interactions, similar to what has been observed between yeast Ubr1p and Ubc2p .

What roles do ATL family proteins play in plant defense responses?

Several ATL family members have been implicated in early plant defense responses against pathogens:

  • Early Response to Elicitors: ATL2 expression is rapidly induced after exposure to chitin or inactivated crude cellulase preparations, which serve as pathogen-associated molecular patterns (PAMPs). This induction is independent of de novo protein synthesis, suggesting ATL2 acts in the early stages of the defense response .

  • Transcript Regulation: ATL2 transcripts accumulate quickly after treatment with elicitors and continue to accumulate even after 120 minutes of incubation with cycloheximide, indicating that its induction is independent of protein synthesis. The presence of a DST element within the 3′UTR of ATL2 may be involved in the rapid degradation of transcripts, contributing to its transient expression pattern .

  • Response to Pathogens: Other ATL family members show similar early and transient responses to PAMPs. For example, ACRE-132, a tobacco ATL gene, is induced within 30 minutes after treatment with the Cladosporium fulvum effector Avr9 in the presence of cycloheximide .

  • Disease Resistance: Some transmembrane RING finger E3 ligases interact with disease resistance proteins, such as RIN2 and RIN3 which interact with the RPM1 disease resistance NBS-LRR protein. Similarly, OsRHC1 from Oryza sativa enhances defense responses when expressed in Arabidopsis thaliana, suggesting a role in a wide range of disease resistances .

What approaches can be used to investigate copy number variations (CNVs) for ATL53 and related genes?

Copy number variations (CNVs) represent an important source of genetic diversity in Arabidopsis thaliana. For investigating CNVs in ATL53 and related genes, researchers have employed several methodologies:

  • Whole-Genome Sequencing (WGS): This approach has been used to generate draft maps of CNVs in Arabidopsis. By analyzing read depth across 80 natural accessions, researchers have identified over 1,000 CNVs covering 1.8% of the Arabidopsis reference genome and affecting more than 500 protein-encoding genes .

  • Locus-Specific Methods:

    • Multiplex Ligation-Dependent Probe Amplification (MLPA): This technique allows for simultaneous quantification of multiple genomic regions. Researchers have designed MLPA assays covering up to 25.5 kb of the Arabidopsis genome, including control probes targeting genes with stable copy numbers located on different chromosomes .

    • Droplet Digital PCR (ddPCR): This method offers high precision for CNV genotyping and has been successfully adapted for plant genome research. It provides an alternative to MLPA for locus-specific CNV analysis .

  • Gene-Specific Primer Analysis: Using primers designed for specific genes or regions allows for targeted analysis of CNVs in accessions with different genotypes .

For effective CNV analysis, a recommended approach is to design an experiment that:

  • Combines multiple methods for cross-validation

  • Includes appropriate controls with known copy numbers

  • Uses statistical methods that account for technical variation

  • Validates findings across multiple biological replicates

What are the optimal conditions for expressing and purifying recombinant ATL53 protein?

Based on established protocols for recombinant ATL53 protein:

Expression System: E. coli is the preferred expression system for recombinant ATL53, typically with an N-terminal His tag for purification purposes .

Purification Method: Affinity chromatography using nickel or cobalt resins is recommended for His-tagged ATL53 purification, followed by size exclusion chromatography if higher purity is required.

Storage and Handling:

  • The purified protein is typically stored as a lyophilized powder .

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Addition of glycerol (final concentration 5-50%, with 50% being common) is recommended before aliquoting for long-term storage .

  • Store working aliquots at 4°C for up to one week .

  • For long-term storage, keep at -20°C or -80°C .

  • Avoid repeated freeze-thaw cycles as this may compromise protein integrity .

Buffer Conditions: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been shown to be effective for maintaining protein stability .

How should experiments be designed to study ATL53 function in plant defense responses?

When designing experiments to study ATL53 function in plant defense responses, consider the following methodological approaches:

  • Experimental Design Considerations:

    • Implement either completely randomized or randomized block designs, with the latter being particularly useful for experiments replicated over time .

    • For complex investigations, consider factorial designs that simultaneously vary multiple independent variables (e.g., elicitor treatment and plant genotype) to obtain more information at little extra cost .

    • Ensure proper controls, including wild-type plants and plants with altered expression of other ATL family members for comparison .

  • Expression Analysis Methods:

    • Given the rapid and transient nature of ATL gene expression in response to elicitors, implement time-course experiments with early time points (e.g., 15, 30, 60, 120 minutes) .

    • Use quantitative RT-PCR to measure transcript levels, with multiple reference genes for normalization .

    • Consider protein-level analysis through western blotting with antibodies against the ATL53 protein or its epitope tag .

  • Functional Analysis Approaches:

    • Generate transgenic plants with altered ATL53 expression (overexpression, knockout, or knockdown) .

    • Use reporter gene fusions (e.g., promoter:GUS) to study spatial and temporal patterns of ATL53 expression in response to different elicitors .

    • Implement protein-protein interaction studies (yeast two-hybrid, co-immunoprecipitation) to identify E2 enzymes and substrates that interact with ATL53 .

  • Statistical Analysis:

    • Use parametric methods such as t-tests or analysis of variance (ANOVA) when assumptions of normality and equal variances are met .

    • For randomized block designs, implement appropriate statistical analyses as demonstrated in the literature .

    • Determine appropriate sample sizes based on power analysis to ensure sufficient statistical power while minimizing resource use .

What techniques can be used to identify potential substrates of ATL53 E3 ubiquitin ligase?

Identifying substrates of E3 ubiquitin ligases like ATL53 requires multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Design bait constructs containing domains of ATL53 likely to mediate protein-protein interactions (excluding the transmembrane domain which may interfere with nuclear localization) .

    • Screen against Arabidopsis cDNA libraries to identify potential interacting proteins.

    • Validate interactions through targeted Y2H assays and co-immunoprecipitation .

  • Immunoprecipitation-Based Methods:

    • Co-immunoprecipitation (Co-IP) using antibodies against tagged ATL53 to pull down interacting proteins.

    • Tandem affinity purification (TAP) using dual-tagged ATL53 for increased specificity.

    • Combine with mass spectrometry for identification of co-purified proteins.

  • Ubiquitination Assays:

    • In vitro ubiquitination assays using purified components (E1, E2, ATL53, and candidate substrates) to directly test substrate ubiquitination.

    • Verify which E2 enzymes work with ATL53, potentially focusing on members of the Ubc4/Ubc5 subfamily known to work with other ATLs .

    • Monitor ubiquitination through western blotting or mass spectrometry.

  • Proteomics Approaches:

    • Global proteome analysis comparing wild-type and ATL53 mutant plants to identify proteins with altered abundance.

    • Enrichment for ubiquitinated proteins using ubiquitin-binding domains or antibodies against ubiquitin followed by mass spectrometry.

    • Di-Gly remnant profiling to identify ubiquitination sites that change in response to ATL53 manipulation.

  • Genetic Approaches:

    • Suppressor/enhancer screens using ATL53 overexpression or knockout lines.

    • Analysis of genetic interactions between ATL53 and candidate substrate genes through double mutant analysis.

    • Phenotypic comparison between ATL53 mutants and candidate substrate mutants to identify shared phenotypes.

How should researchers analyze gene expression data for ATL53 in response to different elicitors?

When analyzing gene expression data for ATL53 in response to different elicitors, consider the following approach:

  • Data Normalization and Quality Control:

    • Normalize expression data using multiple reference genes that maintain stable expression under experimental conditions .

    • Implement quality control measures to identify and address outliers or technical artifacts .

    • Consider using log transformation if the data shows heteroscedasticity .

  • Statistical Analysis Framework:

    • For time-course experiments, use repeated measures ANOVA or mixed-effects models that account for time as a factor .

    • For multiple treatment comparisons, implement appropriate post-hoc tests with correction for multiple comparisons .

    • Consider the following example analysis for a factorial design examining ATL53 expression in response to different elicitors:

Analysis of Variance for ATL53 Expression
Source of Variation
Elicitor Type
Time Point
Elicitor × Time
Residual
  • Interpretation Guidelines:

    • Compare ATL53 expression patterns with those of other known defense-related genes to contextualize the response .

    • Consider the kinetics of expression, particularly the rapid and transient nature observed in other ATL family members .

    • Integrate findings with existing knowledge about ATL family functions in defense responses .

  • Visualization Approaches:

    • Use line graphs with error bars to represent time-course data.

    • Implement heat maps for comparing expression patterns across multiple genes or conditions.

    • Consider principal component analysis (PCA) to identify patterns in complex datasets with multiple variables.

What bioinformatic tools are most appropriate for analyzing the evolutionary relationships among ATL family proteins?

For analyzing evolutionary relationships among ATL family proteins, researchers should consider the following bioinformatic approaches:

  • Sequence Retrieval and Filtering:

    • Implement a systematic approach to retrieve RING-H2 domain-containing sequences from genome databases .

    • Filter sequences based on the presence of canonical features such as the specific spacing between zinc-coordinating residues and the conserved tryptophan residue .

    • Confirm the presence of other ATL-specific features such as the transmembrane domain and GLD motif .

  • Multiple Sequence Alignment:

    • Use algorithms optimized for protein domains, such as MAFFT or MUSCLE, focusing particularly on the RING-H2 domain region.

    • Consider structure-guided alignment approaches when structural information is available.

    • Manually inspect and refine alignments, especially around the conserved zinc-coordinating residues.

  • Phylogenetic Analysis:

    • Employ maximum likelihood or Bayesian inference methods for tree reconstruction.

    • Implement appropriate substitution models selected through model testing.

    • Assess node support through bootstrap analysis or posterior probabilities.

    • Consider the following software for comprehensive analysis:

      • RAxML or IQ-TREE for maximum likelihood tree building

      • MrBayes or BEAST for Bayesian phylogenetic inference

      • MEGA for integrated analysis combining alignment and phylogeny

  • Motif Discovery and Analysis:

    • Use position-specific probability matrix (PSPM) approaches to identify conserved motifs within ATL sequences .

    • Implement tools like MEME Suite to discover novel motifs.

    • Categorize ATLs into groups based on shared motif patterns .

  • Synteny and Gene Duplication Analysis:

    • Analyze the genomic context of ATL genes to identify syntenic relationships.

    • Examine tandemly arrayed ATLs to understand patterns of gene duplication and expansion .

    • Use tools like MCScanX or DAGchainer for synteny analysis.

Through comprehensive bioinformatic analysis, researchers have classified 1815 ATL members from 24 plant genomes into 9 distinct groups, providing a framework for understanding the evolutionary history of this gene family .

How can researchers overcome challenges in protein solubility when working with recombinant ATL53?

Membrane-associated proteins like ATL53 often present solubility challenges during recombinant expression and purification. Consider these approaches:

  • Expression Strategy Optimization:

    • Express truncated versions of ATL53 that exclude the transmembrane domain while retaining functional domains like RING-H2 .

    • Test multiple expression strains, including those specifically designed for membrane proteins (e.g., C41(DE3), C43(DE3)).

    • Optimize induction conditions: lower temperature (16-20°C), reduced IPTG concentration, and longer induction times often improve solubility.

  • Solubilization Approaches:

    • Use mild detergents (DDM, LDAO, or Triton X-100) for membrane protein extraction.

    • Test protein-specific solubilization buffers with varying pH, salt concentration, and additives like glycerol.

    • Consider fusion partners known to enhance solubility (MBP, SUMO, TrxA) with cleavable linkers.

  • Purification Modifications:

    • Implement on-column refolding during affinity purification for proteins recovered from inclusion bodies.

    • Use size exclusion chromatography as a final polishing step to remove aggregates.

    • Consider purification under denaturing conditions followed by step-wise dialysis for refolding.

  • Storage Optimization:

    • Store in buffer containing 6% trehalose to maintain stability .

    • Add 5-50% glycerol to prevent freezing damage during storage .

    • Aliquot into single-use volumes to avoid repeated freeze-thaw cycles .

What controls should be included when studying ATL53 ubiquitin ligase activity?

Proper controls are essential for accurately interpreting ATL53 ubiquitin ligase activity:

  • Negative Controls:

    • Catalytically inactive ATL53 mutant (mutation in critical RING-H2 domain residues) .

    • Reactions lacking essential components (E1, E2, ATP, or ubiquitin).

    • Wild-type protein from a different E3 ligase family with distinct substrate specificity.

  • Positive Controls:

    • Well-characterized E3 ligase with known activity under your experimental conditions.

    • Previously validated ATL family member with demonstrated activity (e.g., ATL2, EL5) .

    • Auto-ubiquitination assay to confirm basic functionality of the purified ATL53.

  • Substrate Controls:

    • Mutated versions of putative substrate proteins at predicted ubiquitination sites.

    • Truncated substrate proteins lacking interaction domains.

    • Competition assays with excess non-ubiquitinatable substrate.

  • Technical Controls:

    • Time-course analysis to establish reaction kinetics.

    • Concentration gradients of key components to identify rate-limiting factors.

    • Reactivity with different E2 enzymes, particularly focusing on the Ubc4/Ubc5 subfamily known to work with ATLs .

Implementing these controls will help differentiate specific ATL53 activity from background reactions and provide a framework for interpreting experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.