Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL61 (ATL61)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATL61; At3g14320; MLN21.11; Putative RING-H2 finger protein ATL61; RING-type E3 ubiquitin transferase ATL61
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL61
Target Protein Sequence
MKESDAVILIHLGINIVFAFFFFGISAVVVSCIIKCYNTHDDDHDHDNNNDGHVSITIKE RVGIKPYVLRSIPIVDFNTKDFKYVLECVVCLSELADGDKARVLPSCDHWFHVECIDSWL QSNSTCPICRKRVCLKQSRTRPELGGRDKSFNQNHDQTSEHHEFSTDPPTNTDTAIIEDG GCGEANEGQPELTAVVIDIPAKEI
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structural organization of the ATL61 protein?

ATL61 belongs to the ATL family of proteins in Arabidopsis thaliana that encode a RING-H2 finger domain. Like approximately 90% of ATL genes, ATL61 is likely intronless, suggesting that its structure evolved as a functional module . The protein contains the characteristic RING-H2 finger domain that is essential for its ubiquitin ligase activity. As a member of the ATL family, ATL61 functions within the ubiquitin/26S proteasome pathway, participating in substrate specification and mediating the transfer of ubiquitin to target proteins .

How is ATL61 related to other members of the ATL family?

ATL61 is one of approximately 80 members of the ATL family identified in Arabidopsis thaliana. The ATL family proteins share conserved features, particularly the RING-H2 finger domain, which is crucial for their function as ubiquitin ligases . Phylogenetic analysis of ATL family members reveals potential evolutionary relationships, with some ATLs showing sequence similarities beyond the conserved domains. Comparative analysis with the 121 ATL members identified in rice (Oryza sativa) indicates that about 60% of rice ATLs cluster with Arabidopsis ATLs, suggesting the presence of orthologous genes that may share similar functions across species .

What are the predicted biochemical properties of recombinant ATL61?

Based on other recombinant proteins expressed in similar systems, recombinant ATL61 would likely have a molecular weight consistent with its amino acid sequence, potentially in the range of 25-30 kDa, similar to other ATL family members . As a RING-H2 finger protein, it would contain the characteristic cysteine and histidine residues arranged in a specific pattern to coordinate zinc ions. The protein is expected to exhibit ubiquitin ligase activity in vitro, demonstrating the ability to facilitate the transfer of ubiquitin from E2 conjugating enzymes to substrate proteins in an ATP-dependent manner .

What are the optimal expression systems for producing recombinant ATL61?

For recombinant ATL61 expression, E. coli-based systems utilizing strains optimized for protein expression such as BL21(DE3)RIL are recommended . The protein coding sequence should be cloned into appropriate expression vectors such as pET series (e.g., pET23d) for high-level expression. For enhanced solubility, fusion tag approaches may be beneficial, such as using NusA-tag systems (pET43.1) or hexahistidyl-tag constructs, which have been successful with other Arabidopsis proteins . For proteins that prove challenging to express in bacterial systems, alternative approaches include yeast expression systems (P. pastoris or S. cerevisiae) or insect cell expression using baculovirus vectors, which may better accommodate plant proteins that require post-translational modifications.

What purification strategy yields the highest purity and activity for ATL61?

The optimal purification strategy for recombinant ATL61 would typically involve a multi-step approach. Initial purification using affinity chromatography (e.g., Ni-NTA for His-tagged proteins) should be followed by secondary purification steps such as ion exchange or size exclusion chromatography . When designing the purification protocol, it's essential to maintain conditions that preserve the structural integrity of the RING-H2 domain, particularly by including zinc ions in buffers to stabilize the zinc finger structure. Purification buffers should be optimized to balance protein solubility with maintaining the native conformation necessary for enzymatic activity. The purification process should culminate in purity assessment via SDS-PAGE and activity validation through ubiquitination assays that demonstrate the protein's ability to facilitate ubiquitin transfer .

How can researchers optimize protein yield while maintaining functional activity?

To optimize recombinant ATL61 yield while preserving functional activity, researchers should systematically evaluate expression conditions including temperature (typically testing 18°C, 25°C, and 37°C), IPTG concentration (ranging from 0.1 to 1.0 mM), and induction duration (4-24 hours). Lower temperatures (18-25°C) often favor proper folding of plant proteins in bacterial systems. The addition of zinc to growth media (10-50 μM ZnCl₂) can promote proper folding of the RING-H2 domain. Solubility enhancers like sorbitol (0.5-1.0 M) and betaine (1-2.5 mM) in culture media may improve protein folding. For proteins prone to aggregation, co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) can be beneficial. Finally, rapid purification at 4°C with protease inhibitors is crucial to minimize degradation, and storage conditions should be optimized to maintain long-term activity, typically in buffers containing 10-20% glycerol at -80°C .

What assays can effectively measure the ubiquitin ligase activity of ATL61?

The ubiquitin ligase activity of ATL61 can be assessed through several methodological approaches. In vitro ubiquitination assays represent the gold standard, requiring purified components including E1 (ubiquitin-activating enzyme), appropriate E2 (ubiquitin-conjugating enzyme), ubiquitin (preferably tagged for detection), ATP, and the purified ATL61 protein. The reaction progress can be monitored via Western blotting using antibodies against ubiquitin or substrate proteins . To identify specific substrates, researchers can employ yeast two-hybrid screens or pull-down assays coupled with mass spectrometry. For in vivo validation, transient expression systems in Arabidopsis protoplasts can be used to observe substrate degradation rates in the presence and absence of proteasome inhibitors. Additionally, FRET-based assays can provide real-time monitoring of ubiquitination activity, where donor-acceptor fluorophore pairs are conjugated to ubiquitin and potential substrates, respectively.

How can substrate specificity of ATL61 be determined?

Determining the substrate specificity of ATL61 requires a multi-faceted approach. Yeast two-hybrid screening can identify potential protein-protein interactions between ATL61 and candidate substrates, while in vitro binding assays using purified components can confirm direct interactions and determine binding kinetics . Proteomics approaches are particularly powerful, including affinity purification coupled with mass spectrometry (AP-MS) to identify proteins that co-purify with tagged ATL61. Comparative proteomics between wild-type and atl61 mutant plants can reveal proteins that accumulate in the absence of ATL61, suggesting they may be substrates. Domain mapping experiments can identify the specific regions of ATL61 involved in substrate recognition. In vivo validation is crucial, typically involving co-expression of ATL61 and candidate substrates in heterologous systems or Arabidopsis, followed by monitoring of substrate protein levels and ubiquitination status .

What methodologies can link ATL61 function to specific plant developmental processes?

To connect ATL61 function to specific developmental processes, researchers should employ a comprehensive genetic and molecular approach. CRISPR/Cas9-mediated gene editing or T-DNA insertion lines can generate atl61 knockout or knockdown mutants, which should be phenotypically characterized across all developmental stages and under various environmental conditions . Complementation studies with wild-type ATL61 can confirm phenotype specificity. Tissue-specific and developmental stage-specific expression analysis using qRT-PCR, RNA-seq, or promoter-reporter fusions (e.g., ATL61pro:GUS) can reveal when and where ATL61 is active. For temporal control, inducible expression systems can allow ATL61 function to be switched on or off at specific developmental stages. Co-expression network analysis can identify genes with expression patterns similar to ATL61, potentially revealing developmental pathways in which it participates. Finally, comparison with phenotypes of other ATL family member mutants may reveal functional redundancy or specialization within the family .

How can quantitative trait locus (QTL) mapping approaches identify natural variation in ATL61 function?

To identify natural variation in ATL61 function through QTL mapping, researchers should utilize diverse Arabidopsis accessions to screen for phenotypic differences potentially associated with ATL61 activity, such as stress responses or developmental traits where ubiquitin-mediated protein degradation plays a role . Advanced Intercross Recombinant Inbred Lines (AI-RILs), which capture increased recombination events, offer superior resolution for QTL mapping compared to standard RIL populations . The EstC and KendC AI-RIL populations, with their high marker density (average intermarker distance of 600 kb) and expanded genetic maps (approximately 50 kb/cM), provide excellent resources for precise QTL mapping of ATL61-related traits . After identifying QTLs, researchers should sequence the ATL61 locus across different accessions to identify polymorphisms, followed by functional validation through complementation tests using transgenic approaches. Association mapping across hundreds of accessions can further validate the role of specific ATL61 polymorphisms in phenotypic variation .

What strategies can resolve contradictory data in ATL61 functional studies?

When faced with contradictory data in ATL61 functional studies, researchers should implement a systematic troubleshooting approach. First, experimental variables should be critically examined, including protein expression conditions, tag positions that might interfere with function, and the specificity of antibodies used . Reproducibility testing across multiple independent experiments with biological replicates is essential. For conflicting in vivo vs. in vitro results, researchers should consider physiological relevance factors such as subcellular localization, post-translational modifications, or interaction partners that may be absent in simplified systems . Using complementary methodological approaches can provide convergent evidence – for example, supporting genetic studies with biochemical assays, or supplementing in vitro results with in vivo validation. For contradictions between ATL61 and other ATL family members, potential redundancy or antagonism should be explored through double or triple mutant analysis . Finally, context-dependent function should be considered, as ATL61 may behave differently under various environmental conditions, developmental stages, or in different tissues .

How can computational modeling predict functional domains and critical residues in ATL61?

Computational modeling of ATL61 functional domains and critical residues requires a multi-level bioinformatic approach. Structure prediction should begin with homology modeling using solved structures of other RING-H2 domain proteins as templates, followed by refinement with molecular dynamics simulations to achieve energy-minimized conformations . Domain prediction tools can identify conserved motifs beyond the RING-H2 domain, including potential substrate recognition domains or regulatory regions. Multiple sequence alignment of ATL family members across species can reveal evolutionarily conserved residues likely critical for function . Machine learning approaches trained on known ubiquitin ligase structures can predict substrate binding sites and catalytic residues. Molecular docking simulations can model interactions between ATL61 and potential E2 conjugating enzymes or substrates. These in silico predictions should be validated experimentally through site-directed mutagenesis of predicted critical residues followed by functional assays to assess the impact on ubiquitin ligase activity .

What are the key considerations when designing CRISPR/Cas9 knockout strategies for ATL61?

When designing CRISPR/Cas9 knockout strategies for ATL61, researchers must consider several critical factors. Target site selection should focus on early exons to ensure complete loss of function, with particular attention to the RING-H2 domain which is essential for ubiquitin ligase activity . Multiple gRNA targets should be designed to increase editing efficiency and provide alternative options in case of failed editing at certain sites. Off-target analysis is crucial, with careful screening of the Arabidopsis genome to identify and avoid potential off-target sites, particularly among other ATL family members that share sequence similarity . For validation, researchers should employ T7 endonuclease assays, high-resolution melting analysis, or direct sequencing to confirm and characterize mutations. Multiple independent transgenic lines should be generated and carried to homozygosity to ensure phenotypic consistency. Additionally, complementation testing with wild-type ATL61 should be performed to confirm that observed phenotypes result specifically from ATL61 disruption rather than off-target effects .

How should researchers design experiments to investigate ATL61 involvement in stress responses?

To investigate ATL61 involvement in stress responses, researchers should implement a comprehensive experimental design. Initial expression profiling should analyze ATL61 transcriptional responses to various stresses (abiotic: drought, salt, cold, heat; biotic: bacterial, fungal, viral pathogens) using qRT-PCR or RNA-seq across different time points and tissues . Comparative phenotypic analysis between atl61 mutants and wild-type plants under controlled stress conditions should assess parameters such as survival rates, growth metrics, stress hormone levels (ABA, SA, JA), and ROS accumulation. Complementation studies with wild-type ATL61 under native or stress-inducible promoters can confirm phenotype specificity. Protein-level analysis should examine ATL61 stability, post-translational modifications, and subcellular localization changes in response to stress using techniques like Western blotting and fluorescent protein fusions . To identify stress-specific substrates, researchers should perform comparative proteomics between wild-type and atl61 mutants under stress conditions. Finally, epistasis analysis with known stress-response pathway mutants can place ATL61 within established signaling networks .

What controls are essential when analyzing promoter activity and expression patterns of ATL61?

When analyzing ATL61 promoter activity and expression patterns, several essential controls must be incorporated. For promoter-reporter constructs (e.g., ATL61pro:GUS or ATL61pro:GFP), researchers should include both positive controls (constitutive promoters like CaMV 35S) and negative controls (promoterless reporter constructs) to establish baseline expression levels . The promoter region selected should be sufficiently large (typically 1.5-3 kb upstream of the start codon) to capture all relevant regulatory elements. Multiple independent transgenic lines (minimum of 10-15) should be analyzed to account for position effects that might influence expression patterns. For developmental studies, expression should be monitored across all major tissues and developmental stages using standardized growth conditions . When investigating promoter responses to environmental stimuli, mock treatments must be conducted in parallel with stress treatments. For quantitative analysis of promoter strength, fluorometric GUS assays or fluorescence quantification should be performed alongside qualitative imaging. Finally, comparison with endogenous ATL61 expression (via qRT-PCR or RNA-seq) is crucial to validate that the promoter-reporter construct accurately reflects native expression patterns .

How does ATL61 function compare with other characterized ATL family proteins?

ATL61 functions as a ubiquitin ligase within the ATL family of RING-H2 finger proteins, similar to other characterized members. The ATL family in Arabidopsis comprises approximately 80 members, many of which participate in the ubiquitin/26S proteasome pathway for protein degradation . While specific functions of ATL61 require further characterization, other ATL family members show diverse roles: ATL43 is involved in ABA response pathways, while ATL8 appears essential for embryogenesis, expressing predominantly in young siliques . The ATL family exhibits a high degree of structural conservation, with 90% being intronless genes, suggesting functional modularity. This structural conservation extends to sequence similarities with rice ATLs, indicating evolutionary conservation of function across species . Despite structural similarities, ATL family members often demonstrate distinct expression patterns and substrate specificities, allowing them to regulate different developmental processes and stress responses. Comparative functional analysis will help determine whether ATL61 exhibits redundancy with other family members or has evolved specialized functions in specific cellular contexts .

What phylogenetic approaches best elucidate the evolutionary history of ATL61?

To elucidate the evolutionary history of ATL61, researchers should employ a comprehensive phylogenetic approach. Multiple sequence alignment of all 80 Arabidopsis ATL proteins and their orthologs from diverse plant species (including monocots, dicots, and basal plants) provides the foundation for evolutionary analysis . Maximum likelihood or Bayesian inference methods are recommended for constructing robust phylogenetic trees, with appropriate evolutionary models selected based on model testing. These analyses should include outgroups from related RING finger protein families to root the phylogenetic trees properly. Synteny analysis across plant genomes can reveal genomic rearrangements affecting ATL61 evolution, while calculating synonymous and non-synonymous substitution rates (dN/dS) can identify sites under positive selection that may indicate functional diversification . Domain architecture analysis can reveal conserved and variable regions among ATL family members. For advanced evolutionary insights, ancestral sequence reconstruction can predict the sequence of ancestral ATL proteins, while gene duplication and loss analysis can track the expansion and contraction of the ATL family throughout plant evolution .

What methodological approaches can determine functional redundancy among ATL family members?

To determine functional redundancy among ATL family members, researchers should implement both genetic and biochemical approaches. Multiple mutant analysis is fundamental, beginning with the generation of double, triple, or higher-order mutants combining atl61 with mutations in phylogenetically related ATL genes . These multiple mutants should be phenotypically characterized to identify enhanced or novel phenotypes that may be masked by redundancy in single mutants. Complementation experiments using ATL61 to rescue other atl mutants (and vice versa) can test functional interchangeability. At the molecular level, substrate specificity comparison through in vitro ubiquitination assays and yeast two-hybrid screens can identify overlapping substrate pools among ATL proteins . Expression analysis using qRT-PCR or RNA-seq should examine compensatory changes in expression of other ATL genes when ATL61 is disrupted. Domain swapping experiments between ATL61 and other family members can identify which protein regions confer functional specificity. For in vivo assessment, fluorescently tagged ATL proteins can reveal shared or distinct subcellular localization patterns. Finally, comparative phenotyping under various environmental conditions can uncover condition-specific functional redundancy .

What strategies address insolubility issues when expressing recombinant ATL61?

To address insolubility issues with recombinant ATL61 expression, researchers should implement a systematic optimization strategy. Fusion tags can significantly enhance solubility, with NusA, MBP, or GST tags often proving more effective than simple His-tags for plant proteins . Expression conditions should be modified by reducing temperature (15-20°C), lowering IPTG concentration (0.1-0.2 mM), and extending induction time (16-24 hours). For E. coli expression, specialized strains designed for difficult proteins (Rosetta, Arctic Express, SHuffle) can improve folding. Co-expression with chaperone proteins (GroEL/GroES, DnaK/DnaJ/GrpE) can facilitate proper folding, while adding zinc ions (10-50 μM) to growth media can stabilize the RING-H2 domain . If bacterial expression remains problematic, alternative systems such as yeast, insect cells, or plant-based expression systems may be more suitable. For extraction, optimization of lysis buffers with various detergents (0.1-1% Triton X-100, CHAPS, or NP-40), higher salt concentrations (300-500 mM NaCl), and stabilizing agents (5-10% glycerol, 1-5 mM EDTA) can improve solubility. Finally, if the protein remains insoluble, refolding from inclusion bodies using gradual dialysis or on-column refolding methods may be necessary .

How can researchers troubleshoot inconsistent ubiquitination activity in ATL61 functional assays?

When encountering inconsistent ubiquitination activity in ATL61 functional assays, researchers should systematically evaluate multiple potential sources of variability. Protein quality assessment is paramount, including verification of structural integrity through circular dichroism or thermal shift assays and confirmation of the RING-H2 domain's zinc coordination via atomic absorption spectroscopy or metal-binding assays . E2 enzyme compatibility should be systematically tested by screening multiple E2 enzymes, as RING-type E3 ligases often show specificity for particular E2 partners. Reaction conditions require optimization, including buffer composition (pH 7.0-8.0), salt concentration (50-150 mM NaCl), temperature (25-30°C), and incubation time (30-90 minutes). The quality and concentration of ATP (1-5 mM) is critical, with fresh preparations recommended for each experiment. Protein stability during storage should be evaluated, with activity testing after various storage conditions (different temperatures, freeze-thaw cycles). For complex formation assays, consider the potential requirement for adaptor proteins or cofactors that might be missing in reconstituted systems. Finally, researchers should standardize protein batches by implementing rigorous quality control metrics and using the same positive controls across experiments to normalize results .

What approaches can identify post-translational modifications affecting ATL61 activity?

To identify post-translational modifications (PTMs) affecting ATL61 activity, researchers should employ a comprehensive analytical workflow. Mass spectrometry-based proteomics serves as the primary approach, with enrichment strategies for specific modifications: phosphopeptide enrichment (TiO2, IMAC) for phosphorylation, lectin affinity chromatography for glycosylation, and ubiquitin remnant immunoprecipitation for ubiquitination . Site-directed mutagenesis of identified modification sites to non-modifiable residues (S/T to A for phosphorylation, K to R for ubiquitination) followed by activity assays can validate functional significance. Temporal dynamics of modifications can be monitored using pulse-chase experiments combined with immunoprecipitation and mass spectrometry. Pharmacological approaches using kinase inhibitors, phosphatase inhibitors, or deubiquitinating enzyme inhibitors can manipulate modification states to assess functional consequences. Western blotting with modification-specific antibodies provides a targeted approach for monitoring known modifications. Protein mobility shift assays (Phos-tag gels for phosphorylation) can detect modifications that alter electrophoretic mobility. For in vivo validation, expressing phosphomimetic (S/T to D/E) or phosphodeficient (S/T to A) mutants in atl61 knockout backgrounds can demonstrate the physiological relevance of specific modifications .

What statistical approaches are appropriate for analyzing ATL61 expression data across developmental stages?

For analyzing ATL61 expression data across developmental stages, researchers should employ robust statistical approaches tailored to the experimental design and data characteristics. For time-course expression data, mixed-effects models are particularly appropriate as they can account for both fixed effects (developmental stage, treatment) and random effects (biological replication, technical variation) . Before analysis, data normalization is essential, with methods such as RPKM/FPKM for RNA-seq data or reference gene normalization for qRT-PCR, followed by log transformation to approximate normal distribution. To identify significant changes across developmental stages, ANOVA with post-hoc tests (Tukey's HSD or Bonferroni correction) can be applied for multiple time points, while paired t-tests or Wilcoxon signed-rank tests may be appropriate for pairwise comparisons . For complex developmental trajectories, regression analysis using polynomial terms can model non-linear expression patterns. Multivariate approaches such as principal component analysis (PCA) or hierarchical clustering can identify co-regulated genes that share expression patterns with ATL61. Power analysis should be conducted to ensure sufficient sample sizes for detecting biologically meaningful differences, with recommended minimum of 3-5 biological replicates per developmental stage .

How should researchers interpret substrate identification data from proteomics studies?

When interpreting substrate identification data from proteomics studies, researchers must implement rigorous filtering and validation strategies. Initial data filtering should prioritize proteins that show significant enrichment in ATL61 pull-downs compared to controls (typically using fold-change ≥2 and p-value ≤0.05) . These potential substrates should display increased abundance in atl61 mutants compared to wild-type plants, consistent with decreased degradation in the absence of the E3 ligase. Functional categorization using Gene Ontology (GO) analysis can reveal biological processes potentially regulated by ATL61, while protein domain analysis may identify common structural features among substrates . Network analysis incorporating protein interaction databases can place potential substrates within biological pathways and identify functional hubs. For validation, targeted experiments should confirm direct interactions between ATL61 and candidate substrates using yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation. In vitro ubiquitination assays with purified components can demonstrate direct ubiquitination, while in vivo substrate stability assays utilizing cycloheximide chase experiments can confirm ATL61-dependent degradation kinetics . Finally, genetic approaches examining whether substrate overexpression phenocopies atl61 mutation can provide functional validation of the regulatory relationship.

What bioinformatic pipelines can predict the impact of natural variation in ATL61 on protein function?

To predict the impact of natural variation in ATL61 on protein function, researchers should implement a comprehensive bioinformatic pipeline that integrates multiple analytical approaches. Sequence acquisition should begin with extracting ATL61 sequences from genome databases of diverse Arabidopsis accessions, followed by multiple sequence alignment to identify polymorphic sites . Variant effect prediction tools (SIFT, PolyPhen-2, PROVEAN) can classify amino acid substitutions as potentially damaging or benign based on evolutionary conservation and physicochemical properties. Structural impact assessment using homology modeling with SWISS-MODEL or I-TASSER can generate 3D protein models for different ATL61 variants, while molecular dynamics simulations can predict how variants affect protein stability and flexibility . Functional domain analysis should focus particularly on variations within the RING-H2 domain that might affect zinc coordination or E2 binding. Conservation analysis across species can distinguish between variation at evolutionarily constrained versus tolerant positions. For splice site or regulatory region variants, tools like SpliceAI or JASPAR can predict impacts on splicing efficiency or transcription factor binding . Integration with QTL data can connect predicted functional impacts to phenotypic variation observed in mapping populations. Finally, co-evolution analysis can identify compensatory mutations that might neutralize potentially damaging variants .

How are advances in structural biology contributing to understanding ATL61 function?

Recent advances in structural biology are significantly enhancing our understanding of RING-H2 finger proteins like ATL61. Cryo-electron microscopy (cryo-EM) has revolutionized the field by enabling visualization of E3 ligase complexes at near-atomic resolution, revealing dynamic conformational changes during the ubiquitination process . X-ray crystallography of related RING-H2 domains has provided detailed insights into zinc coordination geometry and interfaces with E2 enzymes. NMR spectroscopy has proven valuable for characterizing the dynamic properties of RING domains and their interactions with partner proteins in solution . Hydrogen-deuterium exchange mass spectrometry (HDX-MS) is helping identify flexible regions and conformational changes upon substrate binding. Integrative structural biology approaches combining multiple techniques are particularly powerful for elucidating complete structural models of E3 ligase complexes. AlphaFold2 and other AI-based structure prediction tools have dramatically improved the accuracy of protein structure models, allowing researchers to generate reliable structural hypotheses for ATL61 even in the absence of experimental structures . These structural insights enable structure-guided mutagenesis to precisely target residues involved in specific functions, accelerating the functional characterization of ATL61 and facilitating rational design of tools to manipulate its activity in planta.

What emerging technologies will advance our understanding of ATL61 in planta?

Emerging technologies are poised to revolutionize our understanding of ATL61 function in planta. CRISPR-based techniques beyond gene knockout, including base editing and prime editing, allow precise modification of specific ATL61 residues without disrupting the entire gene, enabling fine-tuned functional studies . Proximity labeling methods such as TurboID or APEX2 fused to ATL61 can identify transient interaction partners and potential substrates in their native cellular environment. Optogenetic tools adapted for plant systems enable temporal control of ATL61 activity, allowing researchers to activate or inhibit function in specific tissues or developmental stages using light pulses . Single-cell transcriptomics and proteomics can reveal cell type-specific roles of ATL61 that might be masked in whole-tissue analyses. Live-cell imaging techniques like lattice light-sheet microscopy provide unprecedented spatial and temporal resolution for tracking ATL61 dynamics and interactions. For in vivo monitoring of ubiquitination, fluorescent biosensors can report on ATL61 activity in real time . Synthetic biology approaches including reconstituted ubiquitination circuits can test ATL61 substrate specificity in controlled cellular contexts. Finally, field-deployable phenotyping technologies utilizing multispectral imaging, thermal sensing, and AI-based image analysis can connect ATL61 function to whole-plant phenotypes under natural conditions .

How might understanding ATL61 function contribute to crop improvement strategies?

Understanding ATL61 function could significantly contribute to crop improvement strategies through several applications. If ATL61 is involved in stress response pathways, as suggested for some ATL family members, engineering its expression or activity could enhance crop resilience to abiotic stresses like drought, salinity, or temperature extremes . Comparative genomics between Arabidopsis ATL61 and orthologs in crop species could identify conserved functions amenable to translational research. The ubiquitin ligase activity of ATL61 might be harnessed to target specific proteins for degradation, potentially removing negative regulators of desirable traits or eliminating proteins that contribute to susceptibility to pathogens . Genetic variation studies could identify naturally occurring ATL61 alleles associated with improved agronomic traits, which could be introduced into elite cultivars through precision breeding approaches . CRISPR-based editing of crop orthologs could recreate beneficial ATL61 variants identified in Arabidopsis. If ATL61 regulates developmental processes, manipulating its expression could potentially optimize growth patterns, flowering time, or senescence for increased yield or improved harvest timing . Finally, a comprehensive understanding of ATL61's role in protein homeostasis networks could inform broader strategies for engineering protein degradation pathways to improve crop performance under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.