Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL62 (ATL62)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL62; At3g19140; MVI11.4; Putative RING-H2 finger protein ATL62; RING-type E3 ubiquitin transferase ATL62
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL62
Target Protein Sequence
MNEDALEAVRSRTFFAILTVFYSIFRCCLAYCNKGDDDHLIHPSHSLHVIKATGINPSVL LSIPVVSFNANAFKDNIECVVCLSKFIDEDKARVLPSCNHCFHFDFTDTWLHSDYTCPNC RKNVEEIQNHELSLSPNPNSG
Uniprot No.

Target Background

Gene References Into Functions
  1. The DAY NEUTRAL FLOWERING (DNF) protein, an E3 ligase, represses CO expression during the early part of the day. [PMID: 20818180](https://www.ncbi.nlm.nih.gov/pubmed/20818180)
  2. DNF, an E3 ligase, represses CONSTANS and plays a critical role in Arabidopsis's ability to differentiate between long and short days. [PMID: 20435904](https://www.ncbi.nlm.nih.gov/pubmed/20435904)
Database Links

KEGG: ath:AT3G19140

STRING: 3702.AT3G19140.1

UniGene: At.65108

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ATL gene family in Arabidopsis thaliana?

The ATL (Arabidopsis Tóxicos en Levadura) family comprises a prolific group of RING-H2-type ubiquitin ligases in Arabidopsis thaliana. These proteins are characterized by a highly conserved RING-H2 zinc finger domain that confers E3 ubiquitin ligase activity, enabling them to attach ubiquitin molecules to target proteins, thereby marking them for degradation by the 26S proteasome . The ATL family has evolved through gene duplication events, with several members arranged in tandem clusters within the Arabidopsis genome . ATL proteins typically share common structural features, including hydrophobic domains, a GLD motif (Glycine-rich region), and a RING-H2 domain involved in the interaction with E2 ubiquitin-conjugating enzymes .

How does ATL62 relate to other members of the ATL family?

ATL62 (At3g19140, also known as MVI11.4) is one of the putative RING-H2 finger proteins in the ATL family . While the specific function of ATL62 remains less characterized compared to other family members like ATL2 or ATL6, it shares the conserved RING-H2 domain essential for ubiquitin ligase activity . ATL62 is part of the broader ATL protein network that regulates various cellular processes in Arabidopsis through selective protein degradation. The relationship between ATL62 and other family members can be understood through sequence homology and domain architecture analysis, which reveals evolutionary connections and potential functional overlaps with better-characterized ATL proteins .

How is ATL62 expression regulated in response to stress?

While the specific expression pattern of ATL62 has not been comprehensively documented in the provided search results, insights can be drawn from studies of related ATL family members. Many ATL genes, such as ATL2, demonstrate rapid and transient induction in response to various biotic and abiotic stresses .

ATL2, for example, shows early responsive expression patterns that are independent of de novo protein synthesis, as evidenced by its continued accumulation after cycloheximide treatment . The transcript also exhibits a short half-life due to the presence of a DST element within its 3'UTR, which is involved in rapid transcript degradation .

Based on the common regulatory patterns observed in the ATL family, ATL62 expression may similarly be:

  • Rapidly induced by pathogen-associated molecular patterns (PAMPs)

  • Subject to post-transcriptional regulation mechanisms that ensure transient expression

  • Responsive to specific environmental stresses, particularly those related to plant defense

Researchers investigating ATL62 expression should consider time-course experiments with various stress treatments, including pathogen infection, elicitor application, and abiotic stress conditions, while monitoring transcript levels using qRT-PCR at short time intervals to capture potential rapid and transient expression patterns.

What are the recommended methods for expressing and purifying recombinant ATL62 protein?

Based on successful approaches with other ATL family proteins, the following methodology is recommended for expressing and purifying recombinant ATL62:

  • Cloning strategy:

    • Amplify the ATL62 cDNA coding for the mature protein using gene-specific primers

    • Clone into an expression vector such as pET28a, which provides an N-terminal His-tag for purification

    • Confirm the construct by restriction digestion and DNA sequencing

  • Expression system:

    • Transform the construct into E. coli BL21(DE3) cells

    • Induce protein expression with IPTG (0.5-1 mM) at appropriate temperature (typically 18-25°C to enhance solubility)

    • Evaluate expression by SDS-PAGE analysis under reducing conditions

  • Purification protocol:

    • Extract the inner membrane fraction from E. coli lysate

    • Solubilize membrane-associated ATL62 using detergents such as DDM (n-dodecyl-β-D-maltoside)

    • Perform affinity chromatography using Ni-NTA resin

    • Apply further purification steps as needed (ion exchange, size exclusion chromatography)

  • Verification of purified protein:

    • Confirm identity by Western blot analysis using anti-His antibodies

    • Validate by mass spectrometry (MALDI-TOF/TOF analysis)

    • Assess purity by SDS-PAGE

The following table summarizes typical purification yields and activity metrics based on similar recombinant proteins:

FractionTotal activity (μmol O₂ min⁻¹)Protein yield (mg/500 ml culture)Specific activity (μmol O₂ min⁻¹ mg⁻¹ protein)Recovery (%)
E. coli lysate14.5744.170.33100
Inner membrane29.9519.21.5643.4
Detergent extract20.7617.161.2139.8
Purified protein25.476.63.8614.94

Note: Values are based on similar recombinant protein purification and should be optimized for ATL62 .

How can I validate the E3 ubiquitin ligase activity of recombinant ATL62?

To confirm the E3 ubiquitin ligase activity of purified recombinant ATL62, follow these methodological approaches:

  • In vitro ubiquitination assay:

    • Reaction components: recombinant ATL62, ubiquitin, E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), ATP, and potential substrate

    • Incubate at 30°C for 1-3 hours

    • Analyze by SDS-PAGE and Western blotting using anti-ubiquitin antibodies

    • Include controls: reaction without ATP, without E1, without E2, and without ATL62

  • RING domain mutant analysis:

    • Generate a mutant version of ATL62 with substitutions in critical cysteine residues of the RING domain (e.g., C138 based on ATL2 studies )

    • Compare ubiquitination activity between wild-type and mutant ATL62

    • Loss of activity in the mutant confirms the RING domain's essential role

  • E2 enzyme specificity determination:

    • Test ATL62 activity with different E2 enzymes

    • Identify the most efficient E2 partner(s) for ATL62

    • Characterize the kinetics of the ubiquitination reaction with optimal E2(s)

  • Substrate identification:

    • Perform pull-down assays with ATL62 to identify interacting proteins

    • Test identified proteins as potential ubiquitination substrates

    • Validate interactions using yeast two-hybrid or co-immunoprecipitation methods

What is the role of ATL proteins in plant defense responses?

ATL family proteins play crucial roles in plant defense against pathogens, as evidenced by studies on related family members:

  • Pathogen response regulation:

    • ATL2, a well-characterized family member, is involved in defense responses against fungal pathogens such as Alternaria brassicicola

    • The atl2 null mutant exhibits increased susceptibility to fungal infection, while ATL2-overexpressing plants show enhanced resistance

    • ATL proteins are rapidly induced by pathogen-associated molecular patterns (PAMPs) like chitin, suggesting roles in PAMP-triggered immunity

  • Mechanism of defense:

    • ATL proteins are plasma membrane-localized E3 ubiquitin ligases that likely target defense-related proteins for ubiquitination

    • This post-translational modification may regulate the abundance or activity of defense components

    • In ATL2-overexpressing plants, the expression of fungal virulence genes (e.g., A. brassicicola Cutinase A) is significantly reduced, indicating effective suppression of pathogen virulence

  • Molecular evidence:

    • Trypan blue staining shows weaker hyphal development in ATL-overexpressing plants compared to mutants

    • The localization of ATL proteins to the plasma membrane positions them to detect and respond to extracellular pathogen signals

Based on these findings in related ATL proteins, ATL62 may similarly function in plant defense signaling pathways, potentially by modulating the stability or activity of defense-related components through ubiquitination.

How should I approach contradictory data when studying ATL62 function?

When faced with contradictory data in ATL62 research, follow this systematic approach:

  • Examine the data thoroughly:

    • Identify specific discrepancies between expected and actual results

    • Look for patterns in the contradictions that might indicate systematic errors

    • Pay special attention to outliers that may have influenced the results

  • Evaluate initial assumptions and research design:

    • Reassess the hypothesis and the experimental design

    • Consider whether controls were adequate and properly implemented

    • Evaluate whether the methods used are appropriate for studying E3 ubiquitin ligases

  • Consider alternative explanations:

    • ATL62 may have multiple functions depending on cellular context

    • Redundancy within the ATL family may mask phenotypes in single mutants

    • Post-translational modifications might affect ATL62 activity

  • Modify data collection processes:

    • Adjust experimental conditions (temperature, pH, salt concentration)

    • Test different expression systems or purification methods

    • Implement time-course experiments to capture transient effects

  • Refine variables and implement additional controls:

    • Include related ATL proteins (e.g., ATL2, ATL6) as comparative controls

    • Test substrate specificity with multiple potential targets

    • Evaluate effects in different tissues or developmental stages

A systematic approach using two-variable data tables can help identify patterns in contradictory data:

Variable 1 (e.g., substrate concentration)Result with Condition AResult with Condition BResult with Condition C
Level 1Observed effectObserved effectObserved effect
Level 2Observed effectObserved effectObserved effect
Level 3Observed effectObserved effectObserved effect

This structured analysis can reveal under which specific conditions contradictions occur, potentially leading to new hypotheses about ATL62 function .

How might ATL62 function differ from other characterized ATL family members?

While ATL62 shares structural similarities with other ATL family members, several factors may contribute to functional differentiation:

  • Sequence divergence in substrate recognition domains:

    • The C-terminal region often determines substrate specificity in E3 ligases

    • Sequence analysis shows variation in this region between ATL62 and other family members

    • These differences likely contribute to distinct substrate preferences

  • Expression patterns and regulation:

    • Different ATL proteins show varied expression in response to environmental cues

    • ATL62 may be expressed in specific tissues or developmental stages

    • Temporal regulation may differ from that of well-studied members like ATL2

  • Subcellular localization:

    • While many ATL proteins localize to the plasma membrane (like ATL2 ), subtle differences in localization can affect function

    • Potential interactions with different membrane microdomains could influence substrate accessibility

  • Functional redundancy and specialization:

    • The expansion of the ATL family through gene duplication events has likely led to both redundancy and specialization

    • Some ATL proteins may have evolved novel functions while maintaining the ancestral RING-H2 domain structure

    • ATL62 might participate in unique biological processes not shared with other ATL proteins

  • Interaction with specific E2 enzymes:

    • E3 ligases require specific E2 ubiquitin-conjugating enzymes for activity

    • ATL62 may preferentially interact with different E2 enzymes compared to other family members

    • These preferences could direct ATL62 toward distinct ubiquitination pathways

Researchers investigating the unique functions of ATL62 should consider comparative studies with other ATL proteins, focusing on substrate specificity, expression patterns, and phenotypic analysis of mutants.

What approaches can be used to identify potential substrates of ATL62?

Identifying the substrates of E3 ubiquitin ligases like ATL62 presents significant challenges. The following methodological approaches can be employed:

  • Proximity-based proteomics:

    • BioID or TurboID fusion proteins to label proteins in close proximity to ATL62

    • APEX2-based proximity labeling followed by mass spectrometry

    • These methods capture transient interactions typical of E3-substrate relationships

  • Co-immunoprecipitation combined with ubiquitination assays:

    • Immunoprecipitate ATL62 from plant tissues under various conditions

    • Identify co-precipitating proteins by mass spectrometry

    • Validate potential substrates through in vitro ubiquitination assays

  • Comparative proteomics:

    • Compare protein abundance in wild-type, atl62 knockout, and ATL62-overexpression lines

    • Focus on proteins showing increased abundance in knockout and decreased abundance in overexpression lines

    • Utilize stable isotope labeling techniques (SILAC or TMT) for quantitative comparisons

  • Yeast two-hybrid screening:

    • Use a substrate-binding domain of ATL62 as bait

    • Screen Arabidopsis cDNA libraries for interacting proteins

    • Validate interactions in planta using bimolecular fluorescence complementation (BiFC)

  • Genetic suppressor screens:

    • Identify mutations that suppress phenotypes of ATL62 overexpression

    • Characterize suppressor genes as potential components of ATL62 signaling pathways

    • Test direct interaction and ubiquitination of suppressor gene products

  • In silico prediction:

    • Analyze protein sequences for potential ubiquitination sites

    • Cross-reference with proteins known to function in pathways related to ATL62

    • Prioritize candidates for experimental validation

The integration of multiple approaches is recommended to establish a high-confidence list of ATL62 substrates, as each method has inherent limitations when used in isolation.

How might ATL62 contribute to plant responses to climate change?

Based on studies of related ATL family proteins, ATL62 may play important roles in plant adaptation to changing environmental conditions associated with climate change:

  • Temperature stress response:

    • Studies on ATL31/ATL6 show involvement in plant responses to environmental stressors

    • ATL62 may regulate protein turnover during temperature fluctuations

    • Research should investigate ATL62 expression and function under extreme temperature conditions

  • Carbon/nitrogen balance regulation:

    • ATL31 and ATL6 control carbon/nitrogen nutrient responses in Arabidopsis

    • As climate change alters atmospheric CO₂ levels, ATL62 might participate in adjusting C/N metabolism

    • Experiments comparing wild-type and atl62 mutant responses to varying CO₂ levels could reveal such functions

  • Drought stress adaptation:

    • Changing precipitation patterns will expose plants to increased drought stress

    • E3 ubiquitin ligases often regulate drought response pathways

    • ATL62's potential role in drought adaptation should be investigated through controlled water limitation experiments

  • Trade-offs between stress resistance and fitness:

    • Studies show that increased freezing tolerance in Arabidopsis has fitness costs, affecting reproductive output

    • ATL62 may regulate the balance between stress defense and growth/reproduction

    • Research could examine how ATL62 influences this balance under climate change scenarios

  • Pathogen response under changing conditions:

    • Climate change is altering plant-pathogen interactions and pathogen distributions

    • Given the role of ATL family proteins in defense responses , ATL62 may be crucial for adaptation to emerging pathogens

    • Studies combining pathogen exposure with altered climate variables could reveal such functions

Understanding ATL62's role in these processes could contribute to developing climate-resilient crops through targeted breeding or biotechnological approaches.

What are the most promising avenues for further ATL62 research?

Based on current knowledge of ATL proteins and gaps in understanding, the following research directions for ATL62 are recommended:

  • Comprehensive functional characterization:

    • Generate and phenotype atl62 knockout and overexpression lines

    • Perform detailed expression analysis across tissues, developmental stages, and stress conditions

    • Create fluorescent protein fusions to confirm subcellular localization

  • Substrate identification and validation:

    • Employ proximity labeling and proteomic approaches outlined in section 7.2

    • Focus on proteins involved in stress responses and defense signaling

    • Validate ubiquitination of candidate substrates in vitro and in vivo

  • Structure-function analysis:

    • Determine the three-dimensional structure of ATL62 through X-ray crystallography or cryo-EM

    • Map key residues required for E2 interaction and substrate recognition

    • Design targeted mutations to manipulate ATL62 activity and specificity

  • Integrated multi-omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics analyses of ATL62 mutants

    • Identify broader networks regulated by ATL62-mediated ubiquitination

    • Apply systems biology approaches to model ATL62's role in cellular homeostasis

  • Translational research:

    • Investigate ATL62 orthologs in crop species

    • Assess potential for enhancing stress resistance through manipulation of ATL62 activity

    • Develop molecular markers based on ATL62 variation for marker-assisted breeding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.