Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL69 (ATL69)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL69; At5g07040; MOJ9.21; Putative RING-H2 finger protein ATL69; RING-type E3 ubiquitin transferase ATL69
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL69
Target Protein Sequence
MSPISPPASGVGLGYGIAIAVSILVLISFIMLASYICIRSKSTGRDEATSDVVLDLPSPA AEVKLGLDRPVIESYPRIVLGDSRRLPRPNNGPCSICLCDYEAREPVRCIPECNHCFHTD CVDEWLRTSATCPLCRNSPAPSRLATPLSDLVPLAFQIR
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL69 and how is it classified within the Arabidopsis proteome?

ATL69 (At5g07040) is a putative RING-H2 finger protein that belongs to the ATL (Arabidopsis Tóxicos En Levadura) subfamily of RING-type E3 ubiquitin ligases . It is classified within the RING/U-box superfamily of proteins and is also referred to as a RING-type E3 ubiquitin transferase . The protein is encoded by the gene located on chromosome 5 (At5g07040) and is also identified as MOJ9.21 or MOJ9_21 in some databases . The ATL family, to which ATL69 belongs, represents a prolific group of E3 ubiquitin ligases characterized by their RING-H2 domain, which is essential for their catalytic function in the ubiquitination pathway .

What are the structural characteristics of ATL69?

Based on structural studies of the ATL family, ATL69 likely exhibits the following key structural features:

  • A RING-H2 domain (a variation of the canonical RING finger) with a precise arrangement of 8 zinc ligands essential for E2 enzyme binding

  • A region rich in hydrophobic amino acids that may function as a transmembrane domain

  • A GLD region (named for three conserved amino acids) whose function remains unknown

The three-dimensional structure of ATL RING-H2 finger domains, as determined by NMR spectroscopy for other family members like rice EL5, demonstrates structural features consistent with previously characterized RING domains . The RING-H2 domain directly binds to E2 ubiquitin-conjugating enzymes, forming a functional complex that facilitates the transfer of ubiquitin to target substrates .

What are the recommended protocols for working with recombinant ATL69?

When working with recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL69, researchers should follow these evidence-based protocols:

Storage and Handling:

  • Store at -20°C for regular use or -80°C for long-term storage

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freezing and thawing cycles as this may compromise protein integrity

Form and Preparation:

  • Commercial recombinant ATL69 is typically supplied as a liquid containing glycerol with >90% purity

  • The protein can be expressed in various host systems including E. coli, yeast, baculovirus, or mammalian cells, depending on research requirements

Experimental Applications:

  • Commonly used in biochemical assays such as in vitro ubiquitination assays

  • May be employed in protein-protein interaction studies to identify binding partners

  • Suitable for structural analyses to determine domain-specific functions

How can researchers effectively study ATL69's E3 ligase activity?

To investigate the E3 ligase activity of ATL69, researchers can adapt methodologies used for other ATL family members:

  • In vitro ubiquitination assays:

    • Use purified components including E1 activating enzyme, appropriate E2 conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily), recombinant ATL69, ubiquitin, ATP, and potential substrates

    • Monitor ubiquitin transfer using Western blot analysis with anti-ubiquitin antibodies

  • E2 enzyme selection:

    • Studies with other ATL proteins indicate that they preferentially work with E2 enzymes from the Ubc4/Ubc5 subfamily

    • Researchers should test multiple E2 enzymes from this subfamily to determine optimal activity with ATL69

  • Mutagenesis approaches:

    • Generate key mutations in the RING-H2 domain to identify essential residues for E2 binding

    • Based on studies with other ATLs, mutations in zinc-coordinating residues would likely abolish E3 ligase activity

How does ATL69 compare to other well-characterized ATL family members?

While specific research on ATL69 is limited in the provided search results, comparative analysis with well-studied ATL family members provides valuable insights:

ATL ProteinKey FunctionsStress ResponsesMolecular InteractionsSimilarities to ATL69
ATL31/ATL6E3 ubiquitin ligases; positive regulators of plant immunity and salt stress responseInduced by salt stress; double mutants show increased salt toleranceFunction independently of ABA signaling; undergo proteasomal degradation upon NaCl treatment Likely share RING-H2 domain structure and E2 binding properties
ATL2Early PAMP-responsive geneRapidly induced by PAMPs (chitin, cellulases); transcript accumulates within 30 minExpression independent of de novo protein synthesis; has DST element in 3'UTR for rapid degradation Probably shares similar stress-responsive expression patterns
EL5 (rice)Structurally characterized ATLNot specified in search resultsKey amino acid residues for E2 binding identified; good correlation between E3 activity and E2 interaction Likely has similar RING-H2 domain structure and E2 binding mechanism

The ATL family comprises numerous members with diverse functions, but they share common structural features including the RING-H2 domain essential for E3 ligase activity . Based on studies of other ATL proteins, ATL69 likely plays a role in plant stress responses, possibly in immunity or abiotic stress tolerance.

What is known about the evolutionary conservation of ATL69?

The ATL family is widely conserved across plant species, suggesting important biological functions . While the search results don't provide specific information about ATL69 conservation, insights can be drawn from general ATL family characteristics:

  • The ATL subfamily of RING-type E3 ubiquitin ligases contains multiple members in various plant species, indicating evolutionary significance

  • The characteristic domains (RING-H2, hydrophobic region, and GLD) are conserved features across ATL family members, suggesting functional importance

  • The E2-E3 recognition mechanism appears to be conserved, as studies with rice EL5 (an ATL family member) revealed structural features consistent with other RING domains

  • The involvement of ATL family members in stress responses suggests evolutionary pressure to maintain these genes for plant survival under adverse conditions

What stress response pathways might involve ATL69?

Based on studies of other ATL family members, ATL69 might be involved in the following stress response pathways:

  • Biotic stress responses:

    • Several ATL proteins, including ATL31 and ATL6, positively regulate plant innate immunity

    • ATL2 is rapidly induced by pathogen-associated molecular patterns (PAMPs) like chitin and cellulases

    • ATL69 may similarly function in early PAMP-triggered immune responses

  • Abiotic stress responses:

    • ATL31 and ATL6 are induced by salt stress and regulate plant salt tolerance

    • The double mutant atl31 atl6 exhibits increased salt tolerance, while plants overexpressing ATL31 show increased salt sensitivity

    • ATL69 might play a role in salt stress or other abiotic stress responses

  • Hormone-independent pathways:

    • ATL31 and ATL6 function independently of abscisic acid (ABA) signaling in salt stress response

    • ATL69 may similarly participate in hormone-independent stress response pathways

What experimental approaches are recommended for studying ATL69's role in plant stress responses?

To investigate ATL69's function in plant stress responses, researchers could employ these approaches:

  • Gene expression analysis:

    • Monitor ATL69 expression under various stress conditions (biotic and abiotic)

    • Examine expression kinetics to determine if ATL69 is an early-response gene like ATL2

  • Genetic manipulation:

    • Generate knockout/knockdown mutants using T-DNA insertion lines or CRISPR-Cas9

    • Create overexpression lines to study gain-of-function phenotypes

    • Develop double mutants with related ATL genes to address functional redundancy

  • Stress tolerance assays:

    • Subject ATL69 mutants and overexpression lines to various stresses (salt, drought, pathogens)

    • Compare phenotypes to wild-type and other ATL mutants like atl31 atl6

    • Utilize experimental setups similar to the rainfall-manipulation experiments conducted with Arabidopsis accessions

  • Protein stability studies:

    • Investigate ATL69 protein stability under stress conditions, as NaCl treatment induces proteasomal degradation of ATL31

    • Employ protein synthesis inhibitors like cycloheximide to study protein turnover

How can researchers identify potential substrates of ATL69?

Identifying substrates is crucial for understanding E3 ubiquitin ligase function. For ATL69, researchers could employ these approaches:

  • Yeast two-hybrid screening:

    • Use ATL69 as bait to identify interacting proteins

    • Validate interactions with co-immunoprecipitation and in vitro binding assays

  • Proteomics approaches:

    • Compare ubiquitinated proteomes between wild-type and ATL69 mutant plants

    • Employ tandem ubiquitin binding entities (TUBEs) to enrich ubiquitinated proteins

    • Use quantitative proteomics to identify differentially abundant proteins

  • Genetic suppressor screens:

    • Similar to studies with ATL2 in yeast, where suppressors of toxicity identified potential interactors

    • Screen for genetic suppressors of ATL69 overexpression phenotypes

  • Candidate approach:

    • Test proteins known to be substrates of related ATL proteins

    • Focus on proteins involved in stress pathways regulated by other ATL family members

What is the significance of ATL69 in the context of climate change research?

E3 ubiquitin ligases like ATL69 may play important roles in plant adaptation to changing environmental conditions:

  • Stress tolerance:

    • ATL family members regulate responses to both biotic and abiotic stresses

    • Understanding ATL69's function could reveal mechanisms of plant adaptation to extreme conditions

  • Experimental frameworks:

    • Large-scale studies like the rainfall-manipulation experiment with 517 Arabidopsis accessions provide frameworks for testing ATL69 function under simulated climate change conditions

    • Such experiments allow researchers to quantify fitness traits in controlled environments that mimic future climate scenarios

  • Genetic adaptation:

    • Studies linking genomic data with phenotypic traits under altered environmental conditions can help predict evolutionary impacts of climate change

    • ATL69 variants across Arabidopsis accessions might contribute to differential stress tolerance

  • Applied research potential:

    • Knowledge of ATL69's role in stress responses could inform breeding strategies for climate-resilient crops

    • Understanding the molecular basis of stress tolerance mechanisms involving ATL69 might identify targets for genetic improvement

What are the challenges in expressing and purifying functional ATL69?

Based on general challenges with RING-H2 proteins and information about recombinant ATL69 , researchers should consider:

  • Expression system selection:

    • E. coli systems are commonly used but may not provide post-translational modifications

    • Yeast, baculovirus, or mammalian cell systems may better preserve protein function

    • The choice depends on experimental requirements and downstream applications

  • Solubility considerations:

    • The hydrophobic region in ATL proteins may cause solubility issues

    • Expression of truncated versions (e.g., RING-H2 domain only) may improve solubility

    • Use of solubility tags (MBP, SUMO, etc.) might enhance expression of soluble protein

  • Functional integrity:

    • Ensure proper folding of the RING-H2 domain, which requires correct zinc coordination

    • Supplement expression media with zinc to promote proper folding

    • Verify E3 ligase activity with in vitro assays to confirm functionality

  • Storage stability:

    • Maintain recombinant ATL69 in buffer containing glycerol

    • Store at appropriate temperatures (-20°C or -80°C) to preserve activity

    • Avoid repeated freeze-thaw cycles that can compromise protein integrity

How can researchers validate the functional activity of recombinant ATL69?

To ensure recombinant ATL69 maintains its biological activity, researchers should:

  • Perform in vitro ubiquitination assays:

    • Test with multiple E2 enzymes, particularly from the Ubc4/Ubc5 subfamily

    • Include appropriate controls (RING domain mutants, no E2 control)

    • Verify ubiquitin chain formation by Western blot analysis

  • Assess E2 binding:

    • Conduct pull-down assays to verify interaction with E2 enzymes

    • Compare binding affinity with other ATL family members as reference

  • Evaluate structural integrity:

    • Use circular dichroism or thermal shift assays to assess proper folding

    • Verify zinc content using atomic absorption spectroscopy or colorimetric assays

  • Complementation studies:

    • Test if recombinant ATL69 can complement phenotypes of ATL69 mutants

    • Introduce recombinant protein in cellular systems to assess biological activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.