Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL71 (ATL71)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Expression System:

  • Produced in Escherichia coli with an N-terminal His-tag for purification .

  • Full-length protein (1–197 amino acids) derived from the Arabidopsis thaliana gene ATL71 (UniProt ID: Q9FG21) .

Sequence and Purity:

  • Amino acid sequence includes conserved RING-H2 finger domain (residues 147–197) .

  • Purity exceeds 90% as confirmed by SDS-PAGE .

ParameterSpecification
Molecular Weight~22 kDa (calculated)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol
StabilityAvoid repeated freeze-thaw cycles

Functional Context in the ATL Family

ATL71 belongs to the Arabidopsis Tóxicos en Levadura (ATL) family of RING-H2 ubiquitin ligases, which regulate:

  • Defense Responses: ATL9 confers resistance to powdery mildew via chitin signaling .

  • Stress Adaptation: ATL43 modulates ABA signaling, impacting drought tolerance .

  • Developmental Processes: ATL8 is essential for embryogenesis .

Evolutionary Expansion:

  • A. thaliana has 80 ATL genes, while Oryza sativa (rice) has 121, indicating lineage-specific diversification .

  • 82% of ATLs contain both transmembrane helices and the GLD motif, suggesting strong evolutionary conservation .

Recombinant Production and Applications

Expression Optimization:

  • Arabidopsis-based super-expression systems yield up to 0.4 mg protein per gram fresh weight, ideal for structural studies .

  • Lyophilized ATL71 retains activity when reconstituted with glycerol for long-term storage .

Research Applications:

  • Ubiquitination Assays: Study E3 ligase-substrate interactions using in vitro systems .

  • Structural Biology: AlphaFold models guide mutagenesis studies of the RING-H2 domain .

  • Plant Stress Studies: Compare ATL71 knockout lines to elucidate roles in pathogen response .

Future Directions

  • Functional Validation: Determine substrate specificity using yeast two-hybrid screens .

  • Structural Resolution: Cryo-EM or X-ray crystallography to validate AlphaFold predictions .

  • Crop Engineering: Transfer ATL71 orthologs to crops for enhanced stress tolerance .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, please specify any format requirements in your order notes; we will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.

Synonyms
ATL71; At5g06490; F15M7.2; Putative RING-H2 finger protein ATL71; RING-type E3 ubiquitin transferase ATL71
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL71
Target Protein Sequence
MNATVVPPYSGHWLTNTDRMGGLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTP RTRRRQRESNGTLPPGQERFDFEDDESDTVVVEVLGLTEEVIKGFPKLPYEEARVSYSLQ KESSTTSCCSICLADYKKMDMIRVLPDCNHLFHDNCVDPWLRLHPTCPVCRTSPLPSPAM TPVADVVPFSRRPMMDI
Uniprot No.

Target Background

Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ATL family of proteins?

The ATL (Arabidopsis Tóxicos en Levadura) family represents a specific group of RING-H2 finger domain proteins that function as E3 ubiquitin ligases in plants. These proteins are characterized by their distinctive RING-H2 domain, a hydrophobic region that likely functions as a transmembrane domain, and a conserved GLD region of unknown function. In Arabidopsis thaliana, researchers have identified 80 ATL family members, while rice (Oryza sativa) contains 121 members . Notably, approximately 90% of ATL genes are intronless, suggesting that the basic ATL protein structure evolved as a functional module . Within the broader context, ATLs belong to a class of approximately 470 RING zinc-finger domain proteins that constitute part of the estimated 1300 ubiquitin ligase genes in Arabidopsis .

What is the function of RING-H2 finger proteins like ATL71?

RING-H2 finger proteins like ATL71 function as E3 ubiquitin ligases in the ubiquitin/26S proteasome pathway. These enzymes play critical regulatory roles in protein degradation processes by mediating the transfer of ubiquitin to target proteins . The RING-H2 domain specifically binds to E2 ubiquitin-conjugating enzymes and brings them together with substrate proteins, facilitating ubiquitin transfer . This process marks proteins for degradation by the 26S proteasome, allowing precise control of protein levels in the cell. The specificity of E3 ligases like ATL71 for particular substrates enables targeted regulation of various cellular processes. Structurally, the RING-H2 domain contains a precise arrangement of eight zinc ligands along with other conserved amino acid residues that are essential for E3 ligase activity .

How can I design experiments to investigate the specific substrates of ATL71?

Identifying the specific substrates of ATL71 requires a multi-faceted experimental approach:

  • Yeast Two-Hybrid Screening:

    • Express ATL71 (excluding transmembrane domain) as bait

    • Screen against an Arabidopsis cDNA library

    • Verify interactions with targeted pairwise tests

    • Note: Some ATLs affect yeast viability, which may complicate screening

  • Co-Immunoprecipitation (Co-IP) and Mass Spectrometry:

    • Express epitope-tagged ATL71 in Arabidopsis

    • Perform Co-IP under non-denaturing conditions

    • Analyze co-precipitated proteins by mass spectrometry

    • Include MG132 (proteasome inhibitor) to stabilize ubiquitinated substrates

  • In Vitro Ubiquitination Assays:

    • Purify recombinant ATL71 protein (as described in product specifications)

    • Select appropriate E1 and E2 enzymes (likely from Ubc4/Ubc5 subfamily)

    • Incubate with candidate substrates and analyze ubiquitination by western blot

    • Use site-directed mutagenesis of key RING-H2 domain residues as negative controls

  • Genetic Approaches:

    • Generate ATL71 knockout/overexpression lines

    • Perform quantitative proteomics comparing mutant vs. wild-type plants

    • Focus on proteins with altered abundance or ubiquitination status

    • Consider redundancy with other ATL family members in experimental design

What approaches are recommended for studying ATL71 expression patterns?

Understanding ATL71 expression patterns requires both in silico and experimental approaches:

  • In Silico Expression Analysis:

    • Mine public transcriptome databases (TAIR, BAR eFP Browser)

    • Analyze RNA-seq data across tissues, developmental stages, and stress conditions

    • Compare expression patterns with other ATL family members

    • Note: Other ATL family members show tissue-specific expression patterns; for example, ATL8 is primarily expressed in young siliques

  • Promoter-Reporter Fusion Studies:

    • Clone the ATL71 promoter region (1-2 kb upstream of start codon)

    • Fuse to reporter gene (GUS, GFP, or LUC)

    • Generate stable Arabidopsis transformants

    • Analyze reporter expression across tissues and developmental stages

  • RNA In Situ Hybridization:

    • Design probe specific to ATL71 mRNA

    • Perform in situ hybridization on tissue sections

    • Include sense probe controls to verify specificity

    • This technique allows cellular resolution of expression patterns

  • Quantitative RT-PCR:

    • Design primers specific to ATL71 (avoiding cross-amplification with related ATLs)

    • Extract RNA from different tissues and developmental stages

    • Normalize expression to stable reference genes

    • Include biological and technical replicates for statistical analysis

  • Protein Localization Studies:

    • Generate translational fusions of ATL71 with fluorescent proteins

    • Express under native promoter to maintain physiological expression levels

    • Analyze subcellular localization using confocal microscopy

    • Co-localize with known organelle markers to confirm compartmentation

TechniqueResolutionAdvantagesLimitations
RNA-seqTissueComprehensive, quantitativeLimited spatial resolution
qRT-PCRTissueSensitive, quantitativeLimited spatial resolution
Promoter-ReporterCellularGood spatial resolutionMay miss post-transcriptional regulation
In Situ HybridizationCellularPreserved tissue contextTechnical complexity
Protein FusionSubcellularShows protein localizationPotential tag interference

How can I analyze functional redundancy among ATL family members?

Analyzing functional redundancy among the 80 ATL family members in Arabidopsis requires systematic approaches:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of all ATL proteins

    • Identify closely related members likely to share functions

    • Note that ~60% of rice ATLs cluster with Arabidopsis ATLs, suggesting orthologous relationships

    • Focus on subclades containing ATL71 for redundancy studies

  • Expression Correlation Analysis:

    • Compare expression patterns across tissues and conditions

    • Calculate correlation coefficients between expression profiles

    • Co-expressed ATLs may have redundant functions

    • Use tools like ATTED-II for co-expression network analysis

  • Higher-order Mutant Analysis:

    • Generate double, triple, or higher-order mutants of phylogenetically related ATLs

    • Assess phenotypes compared to single mutants

    • More severe phenotypes in higher-order mutants suggest redundancy

    • Note that some ATL genes (like ATL8) appear essential for viability

  • Complementation Tests:

    • Express ATL71 under control of a related ATL promoter in the corresponding mutant

    • Assess whether ATL71 can rescue the mutant phenotype

    • Cross-complementation indicates functional equivalence

  • Domain Swapping Experiments:

    • Create chimeric proteins by swapping domains between ATL71 and related ATLs

    • Test functionality of chimeric proteins in respective mutant backgrounds

    • Identify domains responsible for specific functions or substrate recognition

  • Comparative Ubiquitination Assays:

    • Purify recombinant proteins of related ATLs

    • Test ubiquitination activity on the same set of candidate substrates

    • Similar substrate preferences suggest functional redundancy

This multi-faceted approach will help determine the degree of functional overlap between ATL71 and other family members, which is crucial for understanding its unique biological roles.

What are the challenges in purifying active recombinant ATL71 for in vitro studies?

Purifying active recombinant ATL71 presents several challenges that must be addressed to ensure functional protein for in vitro studies:

  • Transmembrane Domain Management:

    • The hydrophobic region in ATL71 can cause aggregation and insolubility

    • Options include expressing truncated versions without the transmembrane domain or using detergents for solubilization

    • When using full-length protein, optimize solubilization conditions carefully

  • Maintaining RING-H2 Domain Integrity:

    • The RING-H2 domain coordinates zinc ions essential for structure and function

    • Include zinc (10-50 μM ZnCl₂) in all purification buffers

    • Avoid strong reducing agents or chelators that might disrupt metal binding

    • Use mild reducing agents like DTT (1-5 mM) to maintain cysteine residues

  • Expression System Selection:

    • E. coli expression is commonly used (as for commercial ATL71)

    • Consider eukaryotic systems (yeast, insect cells) if E. coli yields inactive protein

    • Use specialized E. coli strains like Rosetta or SHuffle for problematic expressions

  • Purification Strategy:

    • The commercial ATL71 uses an N-terminal His-tag

    • Consider testing both N and C-terminal tags if function is compromised

    • Include protease inhibitors during extraction to prevent degradation

    • Optimize imidazole concentrations to minimize non-specific binding while maximizing yield

  • Storage Conditions:

    • Store at -20°C/-80°C with glycerol (5-50%) to prevent freeze-damage

    • Avoid repeated freeze-thaw cycles

    • Aliquot protein after purification

    • Working aliquots can be stored at 4°C for up to one week

  • Activity Verification:

    • Develop robust activity assays using appropriate E2 enzymes

    • Test auto-ubiquitination as initial activity confirmation

    • Use circular dichroism or fluorescence spectroscopy to verify proper folding

ChallengeSolutionScientific Basis
Protein solubilityExpress without transmembrane domainHydrophobic regions cause aggregation
Zinc coordinationInclude ZnCl₂ in buffersRING-H2 domain requires zinc for structure
Protein stabilityAdd 5-50% glycerol for storagePrevents ice crystal formation damage
Activity lossAvoid repeated freeze-thawPrevents denaturation cycles
Proper foldingConsider eukaryotic expressionBetter chaperone systems for plant proteins
Tag interferenceTest tag removal or position variationTags can affect protein function

How do I design knockout or knockdown experiments for ATL71?

Designing effective gene disruption experiments for ATL71 requires careful consideration of strategies and controls:

  • T-DNA Insertion Mutants:

    • Search repositories (ABRC, NASC) for available T-DNA insertion lines in ATL71

    • Genotype plants to identify homozygous insertions

    • Verify expression disruption by RT-PCR or qRT-PCR

    • Be aware that ~90% of ATL genes are intronless , which may affect insertion efficiency

  • CRISPR/Cas9 Gene Editing:

    • Design gRNAs targeting the ATL71 coding sequence

    • Focus on the RING-H2 domain for maximum functional disruption

    • Screen for frameshift mutations causing premature stop codons

    • Generate and characterize multiple independent lines

    • Note: Some ATL genes appear essential for viability , so consider conditional approaches

  • RNA Interference (RNAi):

    • Design hairpin constructs specific to ATL71

    • Verify specificity by comparing sequence with other ATL family members

    • Use constitutive or inducible promoters depending on experimental needs

    • Quantify knockdown efficiency by qRT-PCR

    • Test multiple independent transformant lines

  • Artificial microRNA (amiRNA):

    • Design amiRNAs using tools like Web MicroRNA Designer

    • This approach offers more specificity than traditional RNAi

    • Express using appropriate promoters

    • Quantify target transcript reduction

  • Experimental Controls:

    • Include wild-type plants in all experiments

    • Generate complementation lines by expressing ATL71 in the mutant background

    • Consider domain mutants (e.g., RING-H2 domain mutants) as functional controls

    • For assessing phenotypes, grow plants under multiple conditions

  • Phenotypic Analysis:

    • Examine plants at multiple developmental stages

    • Test responses to various hormones, including ABA (as ATL43 shows ABA-insensitive phenotype)

    • Analyze both visible phenotypes and molecular phenotypes

    • Use appropriate statistical designs and analyses3

  • Addressing Redundancy:

    • Consider generating higher-order mutants with closely related ATL genes

    • ATL71 belongs to a family of 80 members in Arabidopsis , so redundancy is likely

How can I interpret contradictory results when studying ATL71 function?

Interpreting contradictory results is a common challenge in functional genomics research. A systematic approach helps reconcile discrepancies:

  • Experimental Context Variation:

    • Document all experimental conditions thoroughly (growth conditions, developmental stage, tissue type)

    • ATL71 function may genuinely differ depending on context

    • Create a comparison table of all experimental variables to identify critical differences

  • Genetic Background Effects:

    • Different Arabidopsis ecotypes can influence gene function

    • Ensure comparisons are made in the same genetic background

    • If using different backgrounds, consider introgressing the mutation

  • Functional Redundancy Analysis:

    • Contradictory results may stem from compensation by other ATL family members

    • Quantify expression of closely related ATLs in your experimental system

    • Consider generating higher-order mutants to overcome redundancy

  • Methodological Differences:

    • Different gene disruption methods (T-DNA, CRISPR, RNAi) can have distinct effects

    • Protein tags for visualization or immunoprecipitation can affect function

    • Standardize methods where possible or verify results using multiple approaches

  • Statistical Approach:

    • Ensure appropriate statistical methods are applied to experimental data3

    • Determine if contradictions are statistically significant or within experimental variation

    • Consider meta-analysis when multiple datasets exist

  • Model Development:

    • Create a conceptual model that can account for seemingly contradictory results

    • Identify testable predictions that could validate your reconciliation model

    • Design experiments specifically to test hypotheses that could explain contradictions

  • Collaborative Resolution:

    • Contact researchers reporting different results to compare methodologies directly

    • Consider joint experiments with standardized protocols

    • Pool data for more powerful statistical analysis

The ubiquitin system's complexity, with over 1300 ubiquitin ligase genes in Arabidopsis , creates numerous opportunities for context-dependent function and regulatory nuance that may explain apparent contradictions in experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.