Recombinant Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3 (GUX3)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3 (GUX3) is a glycosyltransferase enzyme that plays a crucial role in the biosynthesis of xylan, a major component of plant cell walls . Specifically, GUX3 is responsible for adding glucuronic acid (GlcA) residues to the xylan backbone . Xylan, a complex polysaccharide, is the most abundant non-cellulosic component in secondary cell walls, making GUX3 essential for plant biomass production and cell wall structure .

Biochemical Function

GUX3 belongs to the glycosyltransferase family 8 (GT8) and functions as a glucuronyltransferase . It catalyzes the transfer of GlcA from UDP-glucuronic acid to the xylan backbone . The resulting glucuronoxylan consists of a linear chain of β(1,4)-linked xylose residues, with α(1,2)-linked GlcA substitutions .

In Arabidopsis thaliana, the GUX family comprises five members (GUX1-GUX5) . Among them, GUX3 is the only glucuronyltransferase required for the addition of GlcA decorations to xylan in primary cell walls . While GUX1, GUX2, and GUX4 also exhibit xylan α-glucuronosyltransferase activity, GUX3 plays a unique and essential role in primary cell wall synthesis .

Gene Expression and Localization

Expression analysis reveals that GUX3 exhibits a distinct expression pattern compared to other GUX genes . While GUX1 and GUX2 are expressed in both interfascicular fibers and xylem cells, GUX3 expression is primarily observed in xylem cells . This differential expression pattern suggests specialized roles for GUX3 in specific cell types and tissues .

Subcellular localization studies have shown that GUX proteins, including GUX3, are localized to the Golgi apparatus . This localization is consistent with their function in xylan biosynthesis, as the Golgi is the primary site for polysaccharide synthesis and modification in plant cells .

Mutant Analysis

The functional importance of GUX3 has been confirmed through mutant analyses . Studies using T-DNA knockout lines of GUX3 (gux3-1, gux3-2) have demonstrated that GUX3 is essential for the synthesis of primary wall-specific xylan . Specifically, gux3 mutant lines exhibit undetectable quantities of a pentasaccharide known as PUX5, which contains GlcA .

In contrast, gux1gux2 double mutants show reduced levels of another xylan oligosaccharide, [m]UX4, but unaltered abundances of PUX5 . These findings indicate that GUX3 is solely responsible for GlcA substitution of xylan in primary cell walls, while GUX1 and GUX2 have different or overlapping roles .

Role in Primary Cell Wall Synthesis

Transcriptomic and proteomic analyses have revealed a specific set of genes involved in primary cell wall synthesis, including GUX3, IRX9L, IRX10L, and IRX14 . These genes are highly expressed in cells actively synthesizing the primary cell wall, such as Arabidopsis root callus cultures . In contrast, other xylan biosynthetic genes, such as GUX1 and GUX2, exhibit low expression levels in these cells . This suggests that GUX3, along with IRX9L, IRX10L, and IRX14, plays a specialized role in the synthesis of xylan in primary cell walls .

Interaction with Other Enzymes

The biosynthesis of xylan involves the coordinated action of multiple glycosyltransferases and other enzymes . GUX3 interacts with other xylan biosynthetic enzymes, such as IRX9L, IRX10L, and IRX14, to synthesize the xylan backbone and add GlcA substitutions . The precise mechanisms underlying these interactions and the order of enzymatic reactions remain active areas of research.

Impact of GUX3 on Xylan Structure and Function

The activity of GUX3 has a significant impact on the structure and function of xylan . The addition of GlcA residues to the xylan backbone affects its solubility, flexibility, and interactions with other cell wall components . Alterations in xylan structure can, in turn, affect cell wall mechanics, plant growth, and resistance to pathogens .

Potential Applications

Understanding the function of GUX3 and its role in xylan biosynthesis has potential applications in various fields . Modifying GUX3 activity could be used to engineer plants with altered cell wall properties, which could improve biomass digestibility for biofuel production . Additionally, manipulating xylan structure could enhance plant resistance to pathogens or improve the nutritional value of crops .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
GUX3; PGSIP2; At1g77130; T14N5.1; Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3; UDP-GlcA:xylan glucuronyltransferase 3; Glycogenin-like protein 3; Plant glycogenin-like starch initiation protein 2; Protein GLUCURONIC ACID SUBSTITUTION OF XYLAN 3; AtGUX3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-618
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GUX3
Target Protein Sequence
MIPSSSPMESRHRLSFSNEKTSRRRFQRIEKGVKFNTLKLVLICIMLGALFTIYRFRYPP LQIPEIPTSFGLTTDPRYVATAEINWNHMSNLVEKHVFGRSEYQGIGLINLNDNEIDRFK EVTKSDCDHVALHLDYAAKNITWESLYPEWIDEVEEFEVPTCPSLPLIQIPGKPRIDLVI AKLPCDKSGKWSRDVARLHLQLAAARVAASSKGLHNVHVILVSDCFPIPNLFTGQELVAR QGNIWLYKPNLHQLRQKLQLPVGSCELSVPLQAKDNFYSAGAKKEAYATILHSAQFYVCG AIAAAQSIRMSGSTRDLVILVDETISEYHKSGLVAAGWKIQMFQRIRNPNAVPNAYNEWN YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNST FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL LRSKQKAQLEWDRRQAEKGNYKDGHWKIKIKDKRLKTCFEDFCFWESMLWHWGETNSTNN SSTTTTSSPPHKTALPSL
Uniprot No.

Target Background

Function
Putative involvement in xylan backbone substitution within stem glucuronoxylan.
Database Links

KEGG: ath:AT1G77130

STRING: 3702.AT1G77130.1

UniGene: At.27260

Protein Families
Glycosyltransferase 8 family, Glycogenin subfamily
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the primary function of GUX3 in Arabidopsis thaliana?

GUX3 is a glycosyltransferase specifically responsible for adding glucuronic acid (GlcA) decorations to xylan in primary cell walls of Arabidopsis thaliana. Unlike other GUX family members that modify secondary cell wall xylan, GUX3 exclusively decorates the unique primary cell wall xylan structure, designated as PUX 5. Experimental evidence using T-DNA knockout lines revealed that gux3 mutants had undetectable quantities of PUX 5 oligosaccharide but only slight reduction in [m]UX 4, confirming its specialized role in primary cell wall modification .

How does GUX3 differ structurally and functionally from other GUX family members?

GUX3 belongs to the GT8 glycosyltransferase family but has evolved specific functionality distinct from its paralogs GUX1 and GUX2:

GUX ProteinPrimary LocationTarget XylanPattern of SubstitutionKnockout Phenotype
GUX1Secondary cell wallSecondary wall glucuronoxylanWidely spaced, even number of Xyl residues apart ("major" domain)No impact on growth, minor effect on stem strength
GUX2Secondary cell wallSecondary wall glucuronoxylanTightly clustered ("minor" domain)No significant phenotype alone
GUX3Primary cell wallPrimary wall xylan (PUX 5)Regular spacing every six xylosyl residuesNo visible growth phenotype

While GUX1 and GUX2 decorate secondary cell wall xylan with distinctive patterning important for interactions with cellulose fibrils, GUX3 creates a unique xylan structure in primary cell walls that carries a pentose linked 1-2 to the α-1,2-D-glucuronic acid side chains .

What are the most effective methods for studying GUX3 activity in vitro?

To effectively study GUX3 activity in vitro, researchers should implement the following methodological approach:

  • Microsomal preparation: Generate callus from wild-type and gux3 mutant Arabidopsis, then isolate microsomal fractions containing membrane-bound enzymes.

  • XylT/GuxT assays: Conduct xylosyltransferase/glucuronyltransferase activity assays using appropriate acceptors and UDP-GlcA as donors.

  • Product analysis by PACE: Analyze the products using Polysaccharide Analysis by Carbohydrate gel Electrophoresis (PACE) after hydrolysis with specific xylanases.

In experimental validation, microsomes from gux3 callus produced unsubstituted β-1,4-Xyl oligosaccharides with DP 7-14 (DP 11-14 being most abundant), whereas wild-type microsomes produced GlcA-substituted products. This confirms that GUX3 is responsible for essentially all GlcA substitutions in primary cell wall xylan of callus, and demonstrates that XylT activity can proceed without GlcAT activity .

How can researchers effectively generate and validate GUX3 mutants?

A systematic approach to generating and validating GUX3 mutants includes:

  • T-DNA insertion line selection: Identify viable T-DNA insertion lines in public repositories (e.g., SALK, GABI-Kat collections).

  • Homozygous mutant isolation: Use PCR-based genotyping to identify homozygous T-DNA insertion lines, such as gux3-1 and gux3-2.

  • Transcriptional validation: Confirm null expression through RT-PCR or RNA-seq analysis.

  • Biochemical validation:

    • Prepare Alcohol Insoluble Residue (AIR) from tissues

    • Hydrolyze with xylanase

    • Analyze oligosaccharide products by PACE

    • Compare with wild-type controls for absence of PUX 5 structure

  • Complementation testing: To confirm phenotype causality, transform mutants with the wild-type GUX3 gene under its native promoter and verify restoration of the wild-type xylan structure .

How has the GUX gene family evolved across plant species?

The evolution of the GUX gene family exhibits intriguing patterns across the plant kingdom:

  • Concerted evolution: Phylogenetic analysis reveals that GUX1 and GUX3 clades have evolved in a concerted manner rather than independently, particularly in monocots. This means paralogous genes (e.g., GUX1 and GUX3 of monocots) show greater similarity to each other than to their true orthologs in related species .

  • Differential conservation: While analyzing 16 angiosperm species (including six monocots and ten dicots) alongside two bryophyte outgroups, researchers found that different plant lineages retained different numbers of GUX genes.

  • Methodological approach to phylogenetic analysis:

    • Protein sequences were aligned with MAFFT using iterative refinement

    • Maximum likelihood analysis was performed using IQ-Tree with 1,000 ultrafast bootstrap pseudoreplicates

    • Bayesian phylogenetic analysis used MrBayes with 1,000,000 generations

    • Multiple sequence types were tested for robustness (coding sequences, complete gene sequences, gene sequences plus flanking regions) .

This evolutionary understanding provides important context for researchers working across different plant species, as function may not strictly follow nomenclature due to these evolutionary processes .

What approaches can be used to identify GUX3 orthologs in non-model plant species?

To identify GUX3 orthologs in non-model plant species without reference genomes, researchers should employ this systematic workflow:

  • BLAST-based identification: Use the Arabidopsis GUX3 protein sequence as a query for BLAST searches against EST databases or transcriptome assemblies (as demonstrated with sugarcane using the SUCEST database).

  • Contig assembly: For fragmented transcriptome data, assemble contigs using programs like CAP3 from ESTs obtained in BLAST searches.

  • Sequence completion: For incomplete transcripts, use the closest ortholog from a related species (e.g., sorghum for sugarcane) to complete the sequence.

  • Phylogenetic validation: Perform phylogenetic analysis including known GUX proteins to confirm orthology relationships rather than relying solely on sequence similarity.

  • Expression pattern validation: When possible, analyze expression patterns in primary cell wall-rich tissues to validate functional conservation .

This approach was successfully used to identify GUX orthologs across diverse plant species, revealing important evolutionary patterns and functional relationships .

How do IRX9L, IRX10L, IRX14 and GUX3 cooperate in primary cell wall xylan synthesis?

The biosynthesis of primary cell wall xylan involves coordinated activity of multiple enzymes:

  • Expression patterns: Transcriptome analysis of Arabidopsis root callus cultures revealed a primary wall-specific expression pattern for xylan-related biosynthetic genes. Primary wall CESAs (CESA1, CESA3, CESA6) are highly expressed while secondary wall CESAs are essentially undetectable. Among xylan-related genes, IRX9L, IRX10L, IRX14, and GUX3 show high expression, while IRX9, IRX14L, GUX1, and GUX2 have extremely low expression levels .

  • Enzyme roles:

    • IRX9L, IRX10L, and IRX14 are required for backbone synthesis

    • GUX3 adds GlcA decorations to this backbone

  • Functional redundancy: Experiments demonstrate that IRX9 and IRX10 are not involved in primary cell wall xylan synthesis but are functionally exchangeable with IRX9L and IRX10L, suggesting evolutionary conservation of catalytic function despite specialized expression patterns.

  • Enzyme dependencies: Knockout experiments reveal that:

    • Both irx9L and irx14 microsomes lack detectable XylT activity

    • irx10L microsomes retain minimal XylT activity compared to wild-type

    • gux3 microsomes produce unsubstituted xylan oligosaccharides, confirming GUX3 is solely responsible for GlcA decorations

This coordinated enzyme system produces the unique primary cell wall xylan with regular GlcA substitutions every six xylosyl residues, which differs from secondary cell wall xylan structure .

What is the significance of the unique pentose-modified GlcA side chains in primary cell wall xylan?

The primary cell wall xylan decorated by GUX3 contains a distinctive structural feature: a pentose linked 1-2 to the α-1,2-D-glucuronic acid side chains on the β-1,4-Xyl backbone. This structure has several significant implications:

  • Structural uniqueness: This modification is not observed in previously described xylans, suggesting a specialized role in primary cell walls.

  • Regular patterning: The GlcA substitutions occur with precise regular spacing every six xylosyl residues along the backbone, unlike the patterns observed in secondary cell wall xylan.

  • Functional hypothesis: Based on molecular dynamics simulations of similar modifications in secondary cell wall xylan, these decorations likely influence:

    • Non-covalent interactions between xylan and cellulose fibrils

    • The folding properties of the xylan backbone

    • Cross-linking capabilities with other cell wall components

  • Evolutionary conservation: The consistent presence of this unique structure suggests it plays an important functional role that has been maintained through selection pressure.

While the exact functional significance requires further investigation, the distinct structure suggests specialized roles in primary cell wall architecture, possibly related to the different mechanical requirements and expansion properties of primary versus secondary cell walls .

What experimental design approaches are most effective for studying GUX3 function in planta?

When designing experiments to study GUX3 function in planta, researchers should consider a comprehensive experimental design approach:

  • Variable definition and control:

    • Independent variable: GUX3 expression/activity (manipulated through knockout, overexpression, or site-directed mutagenesis)

    • Dependent variables: Xylan structure, cell wall properties, plant phenotypes

    • Control for extraneous variables: growth conditions, developmental stage, tissue specificity

  • Genetic manipulation strategies:

    • Complete knockout via T-DNA insertion or CRISPR-Cas9

    • Tissue-specific knockout using cell type-specific promoters

    • Complementation with wild-type or modified GUX3 variants

    • Generation of higher-order mutants (e.g., gux1gux2gux3)

  • Between-subjects vs. within-subjects design:

    • Between-subjects: Compare different genotypes (WT vs. gux3 vs. complementation lines)

    • Within-subjects: Compare different tissues or developmental stages within the same plant

  • Measurement approaches:

    • Biochemical analysis: Cell wall composition, xylan structure via PACE or mass spectrometry

    • Microscopy: Cell wall architecture, cell expansion patterns

    • Mechanical testing: Cell wall strength, elasticity

    • Transcriptomics: Compensatory responses to GUX3 loss

  • Statistical considerations:

    • Appropriate sample sizes determined by power analysis

    • Biological and technical replicates

    • Suitable statistical tests based on data distribution

How can researchers optimize expression systems for recombinant GUX3 production?

Optimizing recombinant GUX3 production requires careful consideration of expression systems and purification strategies:

  • Expression system selection: Based on published glycosyltransferase studies, researchers should consider:

    • Prokaryotic systems: E. coli BL21(DE3) with solubility enhancement tags (MBP, SUMO, thioredoxin)

    • Eukaryotic systems: Yeast (P. pastoris), insect cells (Sf9), or plant-based expression (N. benthamiana)

    • Cell-free systems: For difficult-to-express membrane-associated proteins

  • Construct design optimization:

    • Remove predicted transmembrane domains while preserving catalytic domains

    • Add affinity tags (His6, GST) for purification

    • Include cleavable signal peptides for secretion in eukaryotic systems

    • Codon optimization for the chosen expression system

  • Expression conditions:

    • For E. coli: Lower temperature (16-20°C), reduced IPTG concentration

    • For eukaryotic systems: Optimize induction timing and nutrient formulations

    • Consider co-expression with chaperones for proper folding

  • Activity validation:

    • Develop in vitro assays using appropriate acceptor oligosaccharides

    • Monitor UDP-GlcA incorporation using radioactive or fluorescent assays

    • Analyze reaction products by mass spectrometry or PACE

  • Purification strategy:

    • Affinity chromatography (IMAC, GST-binding)

    • Size exclusion chromatography for final polishing

    • Consider detergent selection for membrane-associated variants

This methodological approach addresses the challenges of expressing plant glycosyltransferases while maintaining their catalytic activity in recombinant systems .

How can transcriptomic data inform our understanding of GUX3 regulation and function?

Transcriptomic data provides valuable insights into GUX3 regulation and function when analyzed systematically:

Tissue/Cell TypeGUX3 ExpressionIRX9L ExpressionIRX10L ExpressionIRX14 ExpressionBiological Significance
Root callus cultureHighHighHighHighPrimary cell wall synthesis
Young expanding root cellsHighHighHighHighPrimary cell wall expansion
Older root tissue (stele)LowLowLowLowSecondary cell wall formation begins
Mature stemsVery lowLowLowLowPredominantly secondary cell wall synthesis

From transcriptomic data analysis, researchers should:

  • Identify co-expression networks: Analyze genes consistently co-expressed with GUX3 to identify regulatory networks or functional complexes.

  • Study developmental regulation: Track expression changes across developmental stages to understand temporal regulation.

  • Analyze tissue specificity: Compare expression patterns across tissues to identify where GUX3 function is most critical.

  • Examine stress responses: Determine if GUX3 expression changes under different stress conditions, suggesting adaptive cell wall modifications.

  • Integrate with proteomics: Combine with proteomics data to confirm transcript-to-protein correlation and post-translational modifications.

This integrated approach reveals that GUX3 functions within a coordinated gene expression program specific to primary cell wall synthesis, alongside IRX9L, IRX10L, and IRX14, with distinct spatial and temporal regulation compared to secondary cell wall enzymes GUX1 and GUX2 .

What bioinformatic approaches can predict substrate specificity differences between GUX family members?

To predict substrate specificity differences between GUX family members, researchers should implement a multi-layered bioinformatic approach:

  • Sequence-based analysis:

    • Multiple sequence alignment to identify conserved and divergent residues

    • Motif analysis focusing on catalytic domains and substrate-binding regions

    • Calculation of sequence conservation scores across plant species

  • Structural modeling:

    • Homology modeling based on crystallized glycosyltransferases

    • Molecular docking with various potential substrates

    • Molecular dynamics simulations to assess binding stability

  • Evolutionary analysis:

    • Identification of positively selected residues that may drive functional divergence

    • Reconstruction of ancestral sequences to understand evolutionary trajectory

    • Analysis of concerted evolution patterns between GUX1 and GUX3 clades

  • Machine learning approaches:

    • Training models on known glycosyltransferase specificities

    • Feature extraction from sequence and predicted structure

    • Validation through experimental testing of computational predictions

  • Integration with experimental data:

    • Site-directed mutagenesis to test predicted specificity-determining residues

    • In vitro activity assays with different acceptor oligosaccharides

    • Structural validation through crystallography or cryo-EM when possible

This comprehensive bioinformatic workflow can reveal the molecular basis for the observed functional differences between GUX family members, particularly why GUX3 specifically decorates primary cell wall xylan while GUX1 and GUX2 target secondary cell wall xylan with different substitution patterns .

How might CRISPR-Cas9 technology advance our understanding of GUX3 function?

CRISPR-Cas9 technology offers advanced approaches to investigate GUX3 function beyond traditional T-DNA insertion methods:

  • Precise domain editing:

    • Target specific catalytic residues without disrupting the entire protein

    • Create truncated versions to identify minimal functional domains

    • Introduce point mutations to alter substrate specificity

  • Regulatory element manipulation:

    • Edit promoter regions to alter expression patterns

    • Modify enhancers or silencers to understand transcriptional regulation

    • Create reporter fusions at the endogenous locus

  • Multiplexed editing:

    • Simultaneously target multiple GUX family members to overcome functional redundancy

    • Create combinatorial mutants of GUX3 with IRX9L, IRX10L, and IRX14

    • Target entire biosynthetic pathways to understand system-level effects

  • Tissue-specific editing:

    • Deploy tissue-specific Cas9 expression to study cell-specific functions

    • Create mosaic plants to compare mutant and wild-type tissues side-by-side

    • Inducible editing systems to study developmental timing effects

  • Base editing applications:

    • Introduce specific amino acid changes without double-strand breaks

    • Create allelic series to study structure-function relationships

    • Modify glycosylation sites to study post-translational regulation

This advanced genetic toolkit allows researchers to move beyond binary presence/absence studies to understand the mechanistic details of GUX3 function in primary cell wall synthesis with unprecedented precision .

What are the potential implications of GUX3 research for bioenergy and biomaterial applications?

Understanding GUX3 function has significant implications for bioenergy and biomaterial applications:

  • Biofuel production optimization:

    • Modifying GUX3 activity could alter xylan structure to improve enzymatic digestibility

    • Balancing primary and secondary cell wall composition for optimal biomass conversion

    • Tailoring feedstock properties for specific biofuel production processes

  • Cell wall engineering:

    • Precise control over xylan substitution patterns to create designer biomaterials

    • Altering mechanical properties of plant tissues for specific applications

    • Developing crops with modified cell wall architecture for improved processing

  • Biorefinery applications:

    • Utilizing knowledge of GUX3 to develop enzymatic treatments for biomass processing

    • Creating value-added products from xylan derivatives

    • Reducing processing costs through optimized feedstock design

  • Methodological approaches:

    • Transgenic modification of GUX3 expression levels or activity

    • Precision breeding using natural variation in GUX3 alleles

    • Enzyme engineering for in vitro modification of plant biomass

  • Applied research considerations:

    • Field testing of modified plants for agronomic performance

    • Techno-economic analysis of bioprocessing improvements

    • Life cycle assessment of modified biomass utilization

This research provides fundamental knowledge that can lead to significant practical applications, particularly in improving the efficiency of converting plant biomass to biofuels and biochemicals .

How can researchers address inconsistent results in GUX3 activity assays?

When encountering inconsistent results in GUX3 activity assays, researchers should systematically troubleshoot using this methodological approach:

  • Enzyme preparation variables:

    • Verify protein expression through Western blotting

    • Assess protein folding through circular dichroism or limited proteolysis

    • Optimize buffer conditions (pH, ionic strength, detergent concentration)

    • Check for inhibitory contaminants in microsomal preparations

  • Substrate considerations:

    • Verify acceptor oligosaccharide purity and structure

    • Ensure UDP-GlcA is fresh and active

    • Test different acceptor-to-donor ratios

    • Consider competition with endogenous substrates in microsomal preparations

  • Assay conditions optimization:

    • Conduct time-course experiments to establish linearity

    • Optimize temperature and incubation times

    • Test different divalent cation concentrations (Mg²⁺, Mn²⁺)

    • Include appropriate controls (heat-inactivated enzyme, no-acceptor controls)

  • Detection method validation:

    • Compare results across multiple detection methods (PACE, mass spectrometry)

    • Ensure complete product extraction and recovery

    • Develop internal standards for quantification

    • Verify sensitivity and dynamic range of analytical methods

  • Biological variability management:

    • Standardize plant growth conditions

    • Control for developmental stage during tissue harvesting

    • Pool multiple biological samples to minimize individual variation

    • Include appropriate reference samples across experiments

By systematically addressing these variables, researchers can identify sources of inconsistency and establish reliable, reproducible assay conditions for GUX3 activity measurement .

What strategies can resolve challenges in phenotyping subtle cell wall changes in GUX3 mutants?

Detecting subtle cell wall changes in GUX3 mutants requires advanced phenotyping strategies:

  • Enhanced biochemical analysis:

    • Employ sequential extraction to fractionate cell wall components

    • Use highly sensitive mass spectrometry for detailed structural analysis

    • Develop targeted assays for specific xylan structures (e.g., PACE with specific hydrolases)

    • Implement isotope labeling for dynamic turnover studies

  • Advanced microscopy approaches:

    • Super-resolution microscopy to visualize nanoscale cell wall architecture

    • Atomic force microscopy to measure mechanical properties at cellular level

    • Immunolabeling with xylan-specific antibodies to localize structural changes

    • Raman microscopy for non-destructive chemical analysis

  • Mechanical testing refinement:

    • Nanoindentation to measure cell wall modulus at cellular resolution

    • Extensiometry to assess tissue-level mechanical properties

    • Creep tests to evaluate viscoelastic properties

    • Stress relaxation measurements to characterize cell wall dynamics

  • Growth analysis optimization:

    • High-throughput phenotyping platforms for subtle growth differences

    • Root growth assays under varying osmotic or ionic conditions

    • Cell expansion analysis through time-lapse imaging

    • Organ-specific growth measurements under controlled conditions

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify compensatory pathways

    • Statistical methods for detecting subtle but consistent patterns

    • Machine learning approaches to identify complex phenotypic signatures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.