Recombinant Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 (GUX4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 (GUX4)

Recombinant Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 (GUX4) is an enzyme involved in the synthesis of xylan, a major component of plant cell walls. Xylan is crucial for plant structure and function, particularly in secondary cell walls. GUX4 belongs to the Glycosyltransferase Family 8 and plays a role in adding glucuronic acid substitutions to the xylan backbone, which is essential for the structural integrity and functionality of plant cell walls.

Role of GUX4 in Xylan Synthesis

GUX4 is one of several enzymes responsible for modifying xylan by adding glucuronic acid residues. This process is vital for the proper assembly and function of plant cell walls. The enzyme works by transferring glucuronic acid from UDP-glucuronic acid to specific xylose residues on the xylan backbone. This modification affects the physical properties of xylan and its interactions with other cell wall components.

Research Findings and Implications

Research on GUX4 and related enzymes has highlighted their importance in plant cell wall biosynthesis. Studies have shown that mutations or alterations in these enzymes can affect plant growth and cell wall composition. For example, mutations in GUX1 and GUX2 have been shown to significantly reduce the glucuronic acid content in xylan, impacting plant development .

Table 1: Comparison of GUX Enzymes Involved in Xylan Synthesis

EnzymeLocalizationSubstrate SpecificityActivity
GUX1GolgiXylohexaoseHigh
GUX2GolgiXylohexaoseHigh
GUX4GolgiXylohexaoseActive

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
GUX4; PGSIP4; At1g54940; F14C21.47; T24C10.6; Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4; UDP-GlcA:xylan glucuronyltransferase 4; Glycogenin-like protein 4; Plant glycogenin-like starch initiation protein 4; Protein GLUCURONIC ACID SUBSTITUTION OF XYLAN 4; AtGUX4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GUX4
Target Protein Sequence
MGTKTHNSRGKIFMIYLILVSLSLLGLILPFKPLFRITSPSSTLRIDLPSPQVNKNPKWL RLIRNYLPEKRIQVGFLNIDEKERESYEARGPLVLKNIHVPLDHIPKNVTWKSLYPEWIN EEASTCPEIPLPQPEGSDANVDVIVARVPCDGWSANKGLRDVFRLQVNLAAANLAVQSGL RTVNQAVYVVFIGSCGPMHEIFPCDERVMRVEDYWVYKPYLPRLKQKLLMPVGSCQIAPS FAQFGQEAWRPKHEDNLASKAVTALPRRLRVAYVTVLHSSEAYVCGAIALAQSIRQSGSH KDMILLHDHTITNKSLIGLSAAGWNLRLIDRIRSPFSQKDSYNEWNYSKLRVWQVTDYDK LVFIDADFIILKKLDHLFYYPQLSASGNDKVLFNSGIMVLEPSACMFKDLMEKSFKIESY NGGDQGFLNEIFVWWHRLSKRVNTMKYFDEKNHRRHDLPENVEGLHYLGLKPWVCYRDYD CNWDISERRVFASDSVHEKWWKVYDKMSEQLKGYCGLNKNMEKRIEKWRRIAKNNSLPDR HWEIEVRDPRKTNLLVQ
Uniprot No.

Target Background

Function
Putative involvement in xylan backbone substitution within stem glucuronoxylan.
Gene References Into Functions
  1. GUX1, GUX2, and GUX4 exhibit activity as xylan alpha-glucuronosyltransferases. [GUX4] PMID: 22706449
Database Links
Protein Families
Glycosyltransferase 8 family, Glycogenin subfamily
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.