Recombinant Arabidopsis thaliana Receptor protein kinase-like protein At4g34220 (At4g34220)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
At4g34220; F10M10.12; F28A23_20; Receptor protein kinase-like protein At4g34220
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-757
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g34220
Target Protein Sequence
LNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTELGKPNTPDMFRVTSLVL PNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKS VNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSN LLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSL LNQKAESFSGNQELCGKPLKILCSIPSTLSNPPNISETTSPAIAVKPRSTAPINPLTEKP NQTGKSKLKPSTIAAITVADIVGLAFIGLLVLYVYQVRKRRRYPESSKFSFFKFCLEKNE AKKSKPSTTEVTVPESPEAKTTCGSCIILTGGRYDETSTSESDVENQQTVQAFTRTDGGQ LKQSSQTQLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESC AAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSS SSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGL DRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDI DQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKEL VQVLEKICVLV
Uniprot No.

Target Background

Gene References Into Functions
  1. RDK1 positively regulates ABA-inhibited early seedling development by mediating ABI1 translocation to the plasma membrane. (AtRDK1) PMID: 27923613
Database Links

KEGG: ath:AT4G34220

UniGene: At.21017

Protein Families
Protein kinase superfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is At4g34220 and how is it classified?

At4g34220 is also known as RECEPTOR DEAD KINASE 1 (AtRDK1), a receptor protein kinase-like protein in Arabidopsis thaliana. It belongs to the leucine-rich repeat receptor kinase family, which plays critical roles in plant signaling processes. The full-length mature protein spans amino acids 27-757, containing characteristic domains of plant receptor kinases . This protein represents one of the many receptor-like kinases in Arabidopsis that function in various signaling pathways, potentially including stress responses and immunity.

What recombinant forms of At4g34220 are available for research?

Recombinant full-length Arabidopsis thaliana Receptor Protein Kinase-like Protein At4g34220 is available as a His-tagged protein expressed in E. coli. The available construct contains the full length of the mature protein (amino acids 27-757) . The table below summarizes the characteristics of commercially available recombinant At4g34220:

Product InformationSpecification
Protein Full NameRecombinant Full Length Arabidopsis Thaliana Receptor Protein Kinase-Like Protein At4G34220
Source (Expression System)E. coli
SpeciesArabidopsis thaliana
TagHis
Protein LengthFull Length of Mature Protein (27-757)

What genetic resources are available for studying At4g34220 function?

For functional characterization of At4g34220, T-DNA insertion mutant lines are available, specifically SALK_112336 . These mutants can be used for reverse genetics approaches to understand the role of At4g34220 in plant development and responses to various stimuli. When working with these lines, it's essential to identify homozygous mutant and wild-type sibling plants by PCR with gene-specific primers for comparative analyses. This genetic verification ensures that observed phenotypes are specifically associated with the disruption of At4g34220 rather than other genomic differences .

How should fitness assays be designed to evaluate At4g34220 mutant phenotypes?

When designing fitness assays for At4g34220 mutants, researchers should follow these methodological steps:

  • Identify multiple homozygous mutant and wild-type sibling plants by PCR with gene-specific primers (use 2-7 plants per genotype)

  • Harvest seeds from these independent lines (referred to as sublines)

  • Plant these seeds (n = 5–20 per subline, total n ≥ 40 per genotype) for comparison between mutants and their wild-type siblings

  • Use randomized experimental design by randomly assigning genotypes to cells within flats

  • Grow plants under controlled conditions (16-h light/8-h dark cycle, light intensity of 110–130 μmoles/m²/s at 21°C)

  • Measure relevant fitness parameters including seed production and fruit development

This approach minimizes the chance that observed fitness effects result from undetected T-DNA insertions elsewhere in the genome rather than specifically from At4g34220 disruption.

What high-throughput phenotyping methods can be applied to At4g34220 studies?

High-throughput phenotyping of At4g34220 mutants can be accomplished using machine learning approaches for automated counting of Arabidopsis seeds and fruits. Researchers have developed optimized models based on pre-trained frameworks (faster_rcnn_inception_v2_coco) with specific hyperparameter tuning:

  • Test hyperparameters including:

    • Proposals: number of detected regions (seeds) in an image

    • Scales: relative sizes of detected regions

    • Aspect ratios: shapes of the detected regions

  • Implement model training:

    • Use multiple GPUs (three recommended)

    • Run for approximately 40,000 steps

    • Utilize Adam optimizer with a batch size of five

    • Set learning rate to 0.0002

    • Save model checkpoints every 10 minutes

  • Evaluate model performance:

    • Compare predicted seed areas with manually annotated ground truth

    • Use Intersection over Union (IoU) measure with ≥0.5 threshold for correct detection

    • Calculate F-measure score: F1 = 2 × (precision × recall)/(precision + recall)

This methodology enables efficient quantification of fitness parameters in large-scale experiments comparing At4g34220 mutants with wild-type plants.

How can the molecular function of At4g34220 be characterized biochemically?

Characterizing the molecular function of At4g34220 requires multiple biochemical approaches:

  • Kinase Activity Assays: Despite being named "RECEPTOR DEAD KINASE 1," the kinase activity of At4g34220 should be experimentally verified using:

    • In vitro kinase assays with purified recombinant protein

    • Determination of autophosphorylation capacity

    • Identification of potential substrate proteins

    • Analysis of ATP binding capacity

  • Protein-Protein Interaction Studies: To identify interaction partners:

    • Yeast two-hybrid screening against an Arabidopsis cDNA library

    • Co-immunoprecipitation assays using tagged versions of At4g34220

    • Pull-down assays with the recombinant protein

    • Analysis of potential homo- or heterodimerization with other receptor kinases

  • Structural Analysis: Understanding the three-dimensional structure through:

    • X-ray crystallography of the purified protein

    • Homology modeling based on related receptor kinases

    • Analysis of domains crucial for potential ligand binding

These approaches provide complementary insights into At4g34220's biochemical function and its potential role in signaling pathways.

How should experiments be designed to investigate At4g34220's role in stress responses?

To investigate At4g34220's potential role in stress responses, researchers should consider:

  • Transcriptional Analysis:

    • Compare expression levels of At4g34220 under various stress conditions

    • Design experiments that include controls for different water potential treatments (PEG, mannitol, salt) to identify specific vs. general stress responses

    • Analyze both shoots and roots separately as they may show distinct transcriptional responses

  • Phenotypic Comparison Under Stress:

    • Implement controlled drought conditions using soil-free assays with varied water potentials

    • Consider "hard agar" treatment as a high-throughput assay to investigate growth responses to low water potential

    • Compare vermiculite drying versus agar plate-based approaches, as they may elicit different physiological responses

  • Comparative Analysis With Known Stress-Response Mutants:

    • Include known drought-responsive mutants as positive controls

    • Test epistatic relationships through double mutant analysis

    • Measure physiological parameters like stomatal conductance, water use efficiency, and osmolyte accumulation

This multi-faceted approach allows for comprehensive characterization of At4g34220's potential functions in stress response pathways.

What methodologies are appropriate for studying At4g34220 in relation to plant immunity?

If investigating At4g34220's potential role in immunity, researchers should employ:

  • Pathogen Response Assays:

    • Challenge mutants with diverse pathogens (bacterial, fungal, oomycete)

    • Measure classic immune responses like:

      • Seedling growth inhibition

      • Oxidative burst elicitation

      • Ethylene biosynthesis induction

      • Callose deposition

    • Perform electrophysiological measurements to detect plasma membrane depolarization through activation of anion channels

  • DAMP/PAMP Recognition Analysis:

    • Test if At4g34220 functions in pattern recognition, similar to characterized receptors like PEPR1/PEPR2

    • Examine responses to known elicitors (flg22, elf18, AtPeps)

    • Screen for potential novel ligands using bioassays

  • Signaling Pathway Elucidation:

    • Analyze downstream components through phosphoproteomic approaches

    • Investigate potential interactions with common immune signaling components

    • Examine salicylic acid and NPR-dependent responses that may connect with receptor kinase functions

These methodologies provide a comprehensive framework for characterizing At4g34220's potential immune functions, following approaches proven successful with other receptor kinases.

How can transcriptomic analyses be optimized to study At4g34220 function?

Transcriptomic analyses of At4g34220 function should be designed with the following considerations:

  • Experimental Design for RNA-Seq:

    • Compare at4g34220 mutant and wild-type plants under both normal and stress conditions

    • Include tissue-specific sampling (separate analysis of shoots and roots)

    • Consider time-course experiments to capture dynamic transcriptional changes

    • Employ biological replicates (minimum n=3) for statistical robustness

  • Differential Expression Analysis:

    • Identify genes differentially regulated in at4g34220 mutants

    • Focus on genes known to be involved in stress responses or immunity

    • Compare transcriptional profiles with those of other receptor kinase mutants

    • Look for both shared and distinct transcriptional signatures

  • Functional Categorization:

    • Perform Gene Ontology (GO) enrichment analysis

    • Conduct pathway analysis to identify biological processes affected by At4g34220 mutation

    • Validate key differentially expressed genes through qRT-PCR

    • Use clustering methods to identify co-regulated gene networks

This comprehensive transcriptomic approach can reveal downstream targets and pathways regulated by At4g34220, providing insights into its biological function.

How should data from multiple experimental approaches be integrated to build a comprehensive model of At4g34220 function?

Developing a comprehensive model of At4g34220 function requires sophisticated data integration:

  • Multi-omics Data Integration:

    • Combine transcriptomics, proteomics, and metabolomics datasets

    • Apply network analysis methods to identify functional modules

    • Use machine learning approaches to predict functional relationships

    • Implement systems biology modeling to simulate At4g34220's role in signaling networks

  • Cross-species Comparative Analysis:

    • Identify orthologs of At4g34220 in other plant species

    • Compare functional conservation and divergence

    • Use evolutionary analysis to identify conserved functional domains

  • Pathway and Network Reconstruction:

    • Map potential position of At4g34220 within known signaling pathways

    • Identify potential crosstalk with other signaling networks

    • Validate predicted network interactions through targeted experiments

This integrative approach creates a systems-level understanding of At4g34220 function, placing it within the broader context of plant signaling networks.

What methodological approaches address contradictory findings in At4g34220 research?

When confronted with contradictory findings regarding At4g34220 function, researchers should:

  • Experimental Standardization:

    • Carefully control growth conditions and experimental parameters

    • Use multiple independently generated mutant lines

    • Include appropriate genetic controls (complementation lines, multiple alleles)

    • Standardize phenotypic analysis methods across studies

  • Context-Dependent Function Analysis:

    • Test if contradictory results arise from differences in:

      • Developmental stages

      • Environmental conditions

      • Genetic backgrounds

      • Experimental methodologies

    • Design experiments that specifically address these variables

  • Mechanistic Reconciliation:

    • Develop hypotheses that could explain seemingly contradictory findings

    • Design definitive experiments to test these hypotheses

    • Consider redundancy or compensatory mechanisms that might mask phenotypes

This structured approach helps resolve contradictions and builds a more accurate understanding of At4g34220's function across different contexts.

What emerging technologies could advance our understanding of At4g34220 function?

Future research on At4g34220 should leverage emerging technologies including:

  • CRISPR-Cas9 Gene Editing:

    • Generate precise mutations in functional domains

    • Create tagged versions at endogenous loci

    • Implement tissue-specific or inducible knockout systems

    • Develop multiplexed editing to target At4g34220 along with potential redundant genes

  • Advanced Microscopy Techniques:

    • Utilize super-resolution microscopy to localize At4g34220 at subcellular level

    • Apply FRET/FLIM analyses to study protein-protein interactions in vivo

    • Implement live-cell imaging to track dynamic protein behavior

  • Single-Cell Omics:

    • Apply single-cell RNA-seq to identify cell type-specific roles

    • Use spatial transcriptomics to map expression patterns with high resolution

    • Implement single-cell proteomics to detect low-abundance signaling components

These cutting-edge approaches will provide unprecedented insights into At4g34220 function at molecular, cellular, and organismal levels.

How can computational approaches enhance experimental design for At4g34220 research?

Computational approaches can significantly improve experimental design through:

  • In Silico Prediction and Modeling:

    • Predict protein structure and functional domains

    • Model ligand binding and receptor activation

    • Simulate signaling pathway dynamics

    • Identify potential functional redundancy with related proteins

  • Experimental Optimization:

    • Use power analysis to determine optimal sample sizes

    • Implement machine learning for image analysis and phenotyping

    • Design optimal primer sets for gene expression studies

    • Develop computational pipelines for high-throughput data analysis

  • Network-Based Hypothesis Generation:

    • Predict functional partners based on co-expression networks

    • Identify potential pathways using gene set enrichment analysis

    • Generate testable hypotheses based on integrative network analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.