Recombinant Arabidopsis thaliana Reticulon-like protein B10 (RTNLB10)

Shipped with Ice Packs
In Stock

Description

General Information

RTNLB10, also known as At2g15280, F27O10.7, and Reticulon-like protein B10, is a protein found in Arabidopsis thaliana . It is a reticulon-like protein that has been identified as interacting with the FLAGELIN-SENSITIVE2 (FLS2) receptor, which is crucial for pathogen recognition . The recombinant form of this protein is often produced in E. coli for research purposes .

Table 1: RTNLB10 Overview

FeatureDescription
NameReticulon-like protein B10
SpeciesArabidopsis thaliana
SynonymsRTNLB10, At2g15280, F27O10.7, AtRTNLB10
UniProt IDQ6NPD8
Amino Acid Length1-201
Molecular WeightApproximately 22 kDa (based on amino acid sequence)
TagOften expressed with an N-terminal His tag for purification
SourceCommonly produced in E. coli
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0

Structure and Properties

RTNLB10 is a full-length protein consisting of 201 amino acids . It belongs to the reticulon family, characterized by the presence of reticulon domains that facilitate membrane shaping . The protein's amino acid sequence includes hydrophobic regions, suggesting its localization and function within cellular membranes .

Table 2: Amino Acid Sequence and Properties

FeatureDescription
AA SequenceMEESVHQSIRFGSVADLIMWKNRRGGFLLLGSTTLLWFLFEKCGYSFFPFVVNTQLLSVVILFLWAKSAILFNRPMPQLPNLEITEEFVFMVADAIRVWINTVLAVAREIYVGRNAKQLFRVSVVLWTVSFVGNFLNFLTILYLGVVLSLLIPFLYERYQDLIDEKLSLTHRVIQTQYRKIDERLLQKIIAKPTNKIKKMQ
Molecular Weight~22 kDa
Isoelectric PointInformation not available in the provided context.
Secondary StructurePredicted to contain transmembrane domains typical of reticulon proteins.

Function and Significance

RTNLB10 plays a role in plant immunity by modulating the transport of the FLS2 receptor to the plasma membrane . FLS2 is a crucial receptor for recognizing flagellin, a bacterial PAMP (pathogen-associated molecular pattern) .

  • Regulation of FLS2 Trafficking: RTNLB1 and its homolog RTNLB2 regulate the transport of newly synthesized FLS2 to the plasma membrane .

  • Interaction with FLS2: RTNLB1 interacts with FLS2 in vivo, and a Ser-rich region in the N-terminal tail of RTNLB1 is critical for this interaction .

  • Impact on Plant Immunity: Altered expression levels of RTNLB1 and RTNLB2 affect FLS2-dependent signaling and plant susceptibility to pathogens . Plants lacking RTNLB1 and RTNLB2 (rtnlb1 rtnlb2) or overexpressing RTNLB1 (RTNLB1ox) show reduced activation of FLS2 signaling and increased susceptibility to pathogens .

  • Endoplasmic Reticulum Retention: Overexpression of RTNLB1 leads to FLS2 retention in the endoplasmic reticulum (ER), affecting FLS2 glycosylation but not stability .

Table 3: Functional Roles of RTNLB10

Experimental Uses

Recombinant RTNLB10 is utilized in various biochemical and molecular biology applications.

  • Protein Interaction Studies: Recombinant RTNLB10 can be used in pull-down assays and co-immunoprecipitation experiments to validate and study its interaction with FLS2 and other proteins .

  • Structural Studies: The purified protein can be used for structural analysis to understand its domain organization and how it interacts with other proteins .

  • Functional Assays: Recombinant RTNLB10 can be introduced into plant cells to study its effects on FLS2 trafficking and immune signaling .

Table 4: Applications of Recombinant RTNLB10

ApplicationDescription
Protein Interaction AssaysUsed to confirm and study the interaction between RTNLB10 and FLS2, helping to map interacting domains and understand the binding affinity.
Structural BiologyEmployed in crystallization and NMR studies to determine the three-dimensional structure of RTNLB10, providing insights into its function and interactions.
Cellular Localization StudiesUtilized in cell biology experiments to track the movement and localization of RTNLB10 within plant cells, particularly in relation to the endoplasmic reticulum and plasma membrane.
Functional StudiesUsed to assess the impact of RTNLB10 on plant immunity by observing changes in FLS2 signaling, pathogen resistance, and other relevant physiological responses.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
RTNLB10; At2g15280; F27O10.7; Reticulon-like protein B10; AtRTNLB10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB10
Target Protein Sequence
MEESVHQSIRFGSVADLIMWKNRRGGFLLLGSTTLLWFLFEKCGYSFFPFVVNTQLLSVV ILFLWAKSAILFNRPMPQLPNLEITEEFVFMVADAIRVWINTVLAVAREIYVGRNAKQLF RVSVVLWTVSFVGNFLNFLTILYLGVVLSLLIPFLYERYQDLIDEKLSLTHRVIQTQYRK IDERLLQKIIAKPTNKIKKMQ
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G15280

STRING: 3702.AT2G15280.1

UniGene: At.22376

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of RTNLB10 in Arabidopsis thaliana?

RTNLB10 belongs to the reticulon-like protein family in Arabidopsis thaliana, which is involved in shaping the endoplasmic reticulum (ER) membrane. While specific research on RTNLB10 is limited in the provided context, reticulon proteins generally contain reticulon homology domains (RHDs) that insert into the ER membrane, creating and stabilizing membrane curvature. Plant reticulon proteins like RTNLB10 are believed to play crucial roles in ER network formation, protein trafficking, and potentially in plant stress responses.

How does RTNLB10 differ from other reticulon family members in Arabidopsis?

Arabidopsis thaliana contains multiple reticulon-like proteins (RTNLBs), each with potentially specialized functions. RTNLB10 likely has unique expression patterns, subcellular localization characteristics, or interaction partners compared to other family members. Similar to how research has shown that Arabidopsis proteins like ABAP1 have specific interacting partners (such as AIP10) , RTNLB10 likely participates in distinct protein interaction networks that differentiate its function from other RTNLBs.

What are the challenges in expressing recombinant RTNLB10?

Expressing recombinant membrane proteins like RTNLB10 presents several challenges:

  • The hydrophobic nature of reticulon homology domains can cause protein aggregation

  • Proper folding may require specific chaperones or membrane environments

  • Expression systems must be carefully selected to maintain protein functionality

  • Purification protocols must preserve the native structure

For expression of recombinant proteins in Arabidopsis, researchers typically employ methods similar to those used for other membrane proteins, such as using appropriate promoters like UBQ10, as demonstrated in studies of other Arabidopsis membrane proteins .

What expression systems are optimal for producing functional recombinant RTNLB10?

For functional recombinant RTNLB10 production, multiple expression systems can be considered:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, rapid growth, cost-effectiveMembrane proteins may misfold, lack post-translational modificationsInitial biochemical studies, antibody production
Yeast (P. pastoris)Eukaryotic folding machinery, moderate yieldLonger production time than bacteriaStructural studies requiring proper folding
Insect cellsAdvanced eukaryotic folding, good for membrane proteinsTechnical complexity, higher costFunctional studies requiring proper topology
Plant expression (N. benthamiana)Native-like environment, appropriate post-translational modificationsLower yield, more time-consumingInteraction studies, localization experiments

When designing expression constructs, researchers should consider approaches similar to those used for other Arabidopsis membrane proteins, such as incorporating fluorescent protein tags (e.g., GFP, mVenus) to track expression and localization, as demonstrated in studies with other Arabidopsis proteins .

How can I optimize RTNLB10 purification to maintain its native conformation?

Purifying membrane proteins like RTNLB10 while preserving their native conformation requires careful consideration of detergents and buffer conditions:

  • Initial screening of multiple detergents (DDM, LMNG, digitonin) at varying concentrations for efficient extraction

  • Employing affinity purification with His-tags or other fusion partners

  • Utilizing size exclusion chromatography to separate monomeric protein from aggregates

  • Incorporating stability assays to confirm proper folding throughout purification

Similar approaches have been successfully applied to other Arabidopsis membrane proteins, where researchers have used affinity tags and specific buffer conditions to maintain protein integrity during purification .

What methods are most effective for studying RTNLB10 subcellular localization?

Several complementary approaches can be employed to accurately determine RTNLB10 subcellular localization:

  • Fluorescent protein fusion: Creating RTNLB10-GFP/RFP fusions under native or constitutive promoters, similar to approaches used with other Arabidopsis proteins like VHA-a1-GFP and VHA-a3-GFP

  • Immunofluorescence: Using specific antibodies against RTNLB10 for localization in fixed cells

  • Subcellular fractionation: Isolating cellular compartments followed by Western blotting

  • Proximity labeling: Employing BioID or APEX2 fused to RTNLB10 to identify neighboring proteins

  • Co-localization studies: Comparing RTNLB10 distribution with known organelle markers

Researchers should verify localization using multiple methods, as protein overexpression or fusion tags can sometimes affect localization patterns. For instance, the treatment with Brefeldin A (BFA) has been used to confirm TGN/EE localization of Arabidopsis proteins, as demonstrated in studies of VHA-a proteins .

How can protein-protein interaction studies identify RTNLB10 functional partners?

Multiple complementary approaches can be employed to identify RTNLB10 interaction partners:

MethodPrincipleAdvantagesLimitations
Yeast Two-Hybrid (Y2H)Protein interactions activate reporter gene expressionHigh-throughput screening capabilityMay miss membrane protein interactions
Co-immunoprecipitation (Co-IP)Pull-down of protein complexes using antibodiesDetects interactions in near-native conditionsRequires high-quality antibodies
Bimolecular Fluorescence Complementation (BiFC)Protein interactions reconstitute fluorescent proteinVisualizes interactions in living cellsIrreversible complex formation
Förster Resonance Energy Transfer (FRET)Energy transfer between fluorophores in close proximityDetects dynamic interactions in living cellsTechnical complexity
Proximity-dependent Biotin Identification (BioID)Biotinylation of proximal proteinsIdentifies transient or weak interactionsMay label proteins in proximity without direct interaction

Similar approaches have been used successfully with other Arabidopsis proteins, such as in the identification of ABAP1 interaction partners, where Y2H screening and direct Y2H assays confirmed interactions between ABAP1 and AIP10 .

How does RTNLB10 contribute to ER morphology and stress responses in Arabidopsis?

Investigating RTNLB10's role in ER morphology and stress responses requires a multi-faceted approach:

  • Gene knockout or knockdown: Generate RTNLB10 T-DNA insertion lines or CRISPR/Cas9 mutants to observe phenotypic changes, similar to approaches used for other Arabidopsis proteins

  • Overexpression studies: Create lines with constitutive or inducible RTNLB10 expression to observe gain-of-function phenotypes

  • ER imaging: Use fluorescent ER markers in wild-type and mutant backgrounds to visualize changes in ER network morphology

  • Stress assays: Expose plants to various stressors (salt, drought, heat) and compare responses between wild-type and RTNLB10 mutants

  • Transcriptomics: Employ RNA-seq to identify genes differentially expressed in RTNLB10 mutants, similar to approaches used in studies of other Arabidopsis proteins

When analyzing phenotypes, researchers should consider both morphological changes (as observed in studies of other Arabidopsis protein mutants) and potential effects on physiological processes like photosynthesis and carbon fixation.

What structural features of RTNLB10 are critical for its function?

Understanding the structure-function relationship of RTNLB10 requires systematic mutagenesis and domain analysis:

  • Domain deletion/swapping: Generate constructs with specific regions removed or exchanged with homologous domains from other reticulon proteins

  • Site-directed mutagenesis: Target conserved residues for mutation, particularly within the reticulon homology domain

  • Chimeric proteins: Create fusion proteins with domains from different reticulons to assess functional complementation

  • Protein modeling: Use computational approaches to predict structural features and guide mutagenesis

  • Functional complementation: Express mutated versions of RTNLB10 in knockout backgrounds to assess rescue of phenotypes

Similar approaches have been employed with other Arabidopsis proteins, such as the site-directed mutagenesis used to create VHA-a3 R729N mutations for functional studies .

How can I resolve discrepancies in RTNLB10 functional studies across different experimental systems?

When faced with contradictory results about RTNLB10 function from different experimental approaches:

  • Evaluate expression levels: Compare protein abundance across systems, as overexpression may cause artifacts

  • Consider genetic background: Different Arabidopsis ecotypes or mutant backgrounds may influence results

  • Assess experimental conditions: Growth conditions, plant age, and tissue specificity can impact observations

  • Examine methodology differences: Variations in protein tagging, purification methods, or assay conditions may explain discrepancies

  • Perform integrative analysis: Combine data from multiple approaches to develop a consensus model

When comparing results across studies, consider factors such as the specific Arabidopsis ecotype used (e.g., Columbia 0 in many studies) and the methods used to verify protein expression and localization.

What statistical approaches are most appropriate for analyzing RTNLB10 phenotypic data?

Proper statistical analysis of RTNLB10 phenotypic data requires careful consideration:

  • Experimental design: Ensure adequate biological and technical replicates (minimum n=3 for biological replicates)

  • Normality testing: Verify data distribution before selecting parametric or non-parametric tests

  • Multiple comparisons: When comparing multiple genotypes or conditions, apply appropriate corrections (Bonferroni, Tukey, etc.)

  • Effect size calculation: Report not only p-values but also effect sizes to indicate biological significance

  • Data visualization: Present data with appropriate error bars and statistical notation

For complex datasets involving multiple variables, consider multivariate approaches such as principal component analysis or partial least squares discrimination analysis to identify patterns and correlations.

How might high-throughput technologies advance our understanding of RTNLB10 function?

Emerging technologies offer new opportunities for RTNLB10 research:

  • Single-cell transcriptomics: Reveal cell-type-specific expression patterns and responses to perturbations

  • Cryo-electron microscopy: Determine high-resolution structures of RTNLB10 within membranes

  • Advanced imaging techniques: Super-resolution microscopy to visualize ER morphology changes in real-time

  • Proteomics: Quantitative approaches to measure changes in the proteome in response to RTNLB10 manipulation

  • Synthetic biology approaches: Engineer novel RTNLB10 variants with altered functions to probe mechanism

These technologies could help resolve current gaps in our understanding of RTNLB10's precise role in ER membrane dynamics and plant cellular responses.

What are the challenges in translating RTNLB10 research to crop improvement applications?

Applying RTNLB10 research to agricultural contexts presents several challenges:

  • Functional conservation: Determining whether RTNLB10 functions are conserved in crop species

  • Genetic complexity: Navigating potentially redundant reticulon families in polyploid crop genomes

  • Phenotypic trade-offs: Balancing beneficial stress tolerance traits with potential growth penalties

  • Regulatory considerations: Addressing biosafety concerns for genetically modified crops

  • Technical barriers: Developing efficient transformation protocols for target crop species

Researchers should consider comparative genomics approaches to identify RTNLB10 orthologs in crop species and conduct functional studies to verify conserved mechanisms before attempting crop improvement applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.