Recombinant Arabidopsis thaliana Reticulon-like protein B11 (RTNLB11)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Native Function

RTNLB11 belongs to the reticulon family, which modulates endoplasmic reticulum (ER) membrane curvature and vesicular trafficking . In Arabidopsis thaliana, reticulons like RTNLB1/2 regulate the anterograde transport of immune receptors (e.g., FLS2) to the plasma membrane, impacting pathogen response . While RTNLB11’s exact biological role remains understudied, its homology to RTNLB1/2 suggests involvement in ER-mediated protein trafficking and stress signaling.

Protein Interaction Studies

Recombinant RTNLB11 enables investigations into:

  • FLS2 trafficking mechanisms: RTNLB1/2 homologs regulate FLS2 transport to the plasma membrane; RTNLB11 may share similar roles .

  • ER-Golgi dynamics: Reticulons influence vesicle formation and secretory pathways .

Technical Considerations

  • Stability: RTNLB11 requires glycerol buffers and avoidance of repeated freeze-thaw cycles .

  • Activity assays: Co-immunoprecipitation (Co-IP) validated interactions with dynamin-like proteins in homologous systems .

Future Directions

  • Host customization: Arabidopsis-based expression systems (e.g., rdr6-11 mutants) could enhance yield and post-translational accuracy .

  • Humanized glycosylation: Engineering RTNLB11 with mammalian glycoforms may expand therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RTNLB11; At3g19460; MLD14.20; Reticulon-like protein B11; AtRTNLB11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB11
Target Protein Sequence
MGDSVSSSSRVSVHQSLGAGSVADLLLWRNRTGAVILLISSTGFWFLFERAGYNLLSFVS NVLLLLVAIFFLWAKSATVLNRPLPPVPNMEIPEEFANKAADDLRVWINYVLSIASDITI ARNPIRLLQVSLVLWAISYVGTLINSLTLVYIGVLLSLSFPIVYEKYQDHIDEKVNSTSK FVRNISRKFPLPINKEKKHQ
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G19460

UniGene: At.38403

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of RTNLB11 compared to other reticulon-like proteins in Arabidopsis?

RTNLB11 belongs to the reticulon-like protein family in Arabidopsis, characterized by conserved reticulon homology domains (RHDs). Like its homologs RTNLB1 and RTNLB2, RTNLB11 likely contains transmembrane domains (TDMs) that adopt a hairpin-like structure within the endoplasmic reticulum (ER) membrane. Based on structural studies of related RTNLBs, RTNLB11 would be expected to have cytosolic N-terminal and C-terminal regions, with variable low complexity regions (LCRs) in the N-terminal domain that may confer functional specificity .

For experimental characterization, researchers should consider:

  • Conducting topology mapping using protease protection assays

  • Employing fluorescent protein tagging at N- and C-termini to confirm membrane orientation

  • Performing deletion analysis of putative functional domains to assess their contributions

How does RTNLB11 expression respond to biotic and abiotic stresses?

While specific RTNLB11 stress responses are still being characterized, related family members like RTNLB1 show significant upregulation during pathogen-associated molecular pattern (PAMP)-triggered immunity. RTNLB1 transcript levels increase approximately threefold within 3 hours of flg22 (a bacterial flagellin fragment) treatment in an FLS2-dependent manner .

To investigate RTNLB11 stress responsiveness, researchers should:

  • Perform quantitative RT-PCR analysis across a time course of various stress treatments

  • Compare expression patterns in wild-type versus immune receptor mutant backgrounds

  • Utilize promoter-reporter constructs to visualize tissue-specific expression patterns during stress responses

What approaches are recommended for generating recombinant RTNLB11 for in vitro studies?

For successful production of recombinant RTNLB11:

  • Expression system selection:

    • Bacterial systems (E. coli): Suitable for producing soluble domains but challenging for full-length membrane proteins

    • Insect cell systems: Better for maintaining proper folding of transmembrane regions

    • Plant-based expression: Provides native post-translational modifications

  • Purification strategy:

    • Consider detergent screening to identify optimal solubilization conditions

    • Employ affinity tags (His, GST, MBP) positioned to avoid interference with membrane insertion

    • Use size exclusion chromatography for final purification steps

  • Functional verification:

    • Circular dichroism to confirm secondary structure integrity

    • Liposome association assays to verify membrane binding properties

How do protein-protein interactions differ between RTNLB11 and other family members in the context of plant immunity?

Research on RTNLB1 and RTNLB2 demonstrates their interaction with the immune receptor FLS2, with specific regions like the Ser-rich region (LCR2) in the N-terminal tail of RTNLB1 being critical for this interaction . For RTNLB11, interaction partners likely include both overlapping and distinct proteins compared to other family members.

Recommended methodological approaches include:

MethodApplicationAdvantagesLimitations
Co-immunoprecipitationIn vivo confirmation of interactionsPreserves native conditionsMay miss transient interactions
Yeast two-hybridScreening for potential partnersHigh-throughput capabilityMay produce false positives with membrane proteins
BiFC/FRETSpatial visualization of interactionsProvides subcellular resolutionPotential artifacts from overexpression
Protein microarraysSystematic screeningUnbiased approachLimited to available proteins on array

When interpreting interaction data, researchers should consider that:

  • Multiple regions of reticulon proteins may contribute to binding partners, as seen with RTNLB1's interaction with FLS2 involving both N-terminal regions and transmembrane loops

  • Interaction networks may be dynamically regulated by developmental stage and stress conditions

What are the mechanisms by which RTNLB11 affects protein trafficking in plant cells?

Based on knowledge of related reticulon proteins, RTNLB11 likely influences protein trafficking through ER membrane shaping and/or direct interactions with cargo proteins. Studies with RTNLB1 and RTNLB2 reveal that their manipulation affects FLS2 accumulation at the plasma membrane, suggesting a role in anterograde transport from the ER to the plasma membrane .

To investigate RTNLB11's role in trafficking:

  • Generate transgenic plants with altered RTNLB11 expression:

    • Knockout/knockdown lines (T-DNA insertion mutants, CRISPR/Cas9, RNAi)

    • Overexpression lines under constitutive or inducible promoters

  • Analyze effects on model cargo proteins:

    • Quantify secretion efficiency using secreted luciferase reporters

    • Track fluorescently-tagged membrane proteins through the secretory pathway

    • Perform electron microscopy to examine ER morphology changes

  • Conduct time-resolved trafficking assays:

    • Implement fluorescence recovery after photobleaching (FRAP) to measure mobility

    • Use temperature-sensitive trafficking blocks combined with synchronized release

When interpreting trafficking data, consider that both loss-of-function and gain-of-function approaches may produce trafficking defects, as observed with RTNLB1 where both knockout and overexpression lines showed impaired FLS2 signaling .

How can CRISPR/Cas9 gene editing be optimized for studying RTNLB11 function?

For effective CRISPR/Cas9 editing of RTNLB11:

  • Guide RNA design considerations:

    • Target conserved functional domains to ensure phenotypic effects

    • Select targets with minimal off-target potential across the Arabidopsis genome

    • Consider targeting different exons to generate a series of truncated variants

  • Validation strategies:

    • Perform thorough genotyping using a combination of PCR, sequencing, and restriction enzyme digestion

    • Quantify RTNLB11 transcript and protein levels in edited lines

    • Confirm specificity by examining expression of other RTNLB family members

  • Phenotypic analysis:

    • Examine subcellular organization, particularly ER morphology

    • Assess immune responses to standard PAMPs like flg22

    • Evaluate developmental parameters under normal and stress conditions

What controls are essential when investigating RTNLB11's role in plant immunity?

When studying RTNLB11 in immunity contexts, include these critical controls:

  • Genetic controls:

    • Wild-type plants (Col-0 for Arabidopsis)

    • Known immune receptor mutants (e.g., fls2 mutant as used in RTNLB1/2 studies)

    • Mutants of related RTNLB family members for comparison

    • Complementation lines restoring RTNLB11 expression in knockout backgrounds

  • Treatment controls:

    • Mock treatments matched to elicitor solvent

    • Time-course sampling to capture dynamic responses

    • Use of multiple elicitors to distinguish pathway specificity

  • Expression controls:

    • Employ multiple reference genes for qRT-PCR normalization

    • Verify antibody specificity when performing immunoblotting

    • Use fluorescent protein fusions with proper localization controls

When analyzing immunity data, consider that both knockout and overexpression of RTNLBs can impair immune signaling, as seen with RTNLB1 where overexpression lines (RTNLB1ox) displayed severe impairment in MAPK activation and immune marker expression at similar levels to fls2 mutants .

How should researchers approach the functional redundancy among RTNLB family members?

The Arabidopsis genome encodes multiple RTNLB proteins with potentially overlapping functions. Studies with RTNLB1 and RTNLB2 indicate partial redundancy, as individual mutants show milder phenotypes than double mutants .

To address functional redundancy when studying RTNLB11:

  • Generate and characterize multiple mutant combinations:

    • Create single, double, and higher-order mutants with phylogenetically related RTNLBs

    • Use inducible amiRNA or CRISPR interference for temporal control of gene silencing

    • Develop tissue-specific knockdowns to avoid developmental confounds

  • Design domain-swapping experiments:

    • Create chimeric proteins exchanging domains between RTNLB family members

    • Express these under native promoters in appropriate mutant backgrounds

    • Assess restoration of function through molecular and physiological assays

  • Transcriptome analysis approaches:

    • Compare expression patterns across tissues and conditions

    • Identify co-regulated gene networks

    • Look for compensatory upregulation of related family members in mutant backgrounds

How should researchers interpret contradictory phenotypes between RTNLB11 knockout and overexpression lines?

When facing contradictory phenotypes, consider these analytical approaches:

  • Dosage-dependent effects:

    • Generate an expression series with multiple independent lines showing varying expression levels

    • Quantitatively correlate expression levels with phenotypic strength

    • Consider that both loss and excess of RTNLBs can disrupt optimal membrane curvature

  • Context-dependent functions:

    • Examine phenotypes across different tissues and developmental stages

    • Test under various stress conditions to reveal conditional phenotypes

    • Consider that RTNLBs may have opposing functions in different cellular contexts

  • Compensatory mechanisms:

    • Analyze expression of other RTNLB family members in your lines

    • Perform time-course analyses to capture transient versus stable responses

    • Consider that overexpression can trigger post-translational regulation not present in wild-type conditions

As observed with RTNLB1, both knockout (rtnlb1 rtnlb2) and overexpression (RTNLB1ox) lines exhibited impaired immune signaling, suggesting that proper RTNLB levels are critical for optimal function rather than simply more or less being better .

What statistical approaches are most appropriate for analyzing RTNLB11 phenotypic data?

For robust statistical analysis of RTNLB11 research data:

  • Experimental design considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Include biological replicates (independent plants) and technical replicates

    • Use randomized complete block designs to control for environmental variation

  • Statistical methods for different data types:

    Data TypeRecommended TestsImportant Considerations
    Gene expression (qRT-PCR)ANOVA with post-hoc tests, linear mixed modelsLog-transform data if not normally distributed
    Protein abundanceNon-parametric tests for immunoblot quantificationInclude loading controls and normalize properly
    Microscopy/localizationColocalization coefficients, distribution analysesAnalyze sufficient cells to capture population variation
    Phenotypic measurementsANOVA, regression analysisControl for developmental stage differences
  • Advanced approaches for complex datasets:

    • Consider multivariate analyses to capture correlated phenotypes

    • Use hierarchical clustering to identify patterns across multiple parameters

    • Implement machine learning approaches for complex image-based phenotyping

What emerging technologies will advance our understanding of RTNLB11 function?

Cutting-edge approaches to enhance RTNLB11 research include:

  • Structural biology techniques:

    • Cryo-electron microscopy for membrane protein complexes

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

    • AlphaFold2 or RoseTTAFold for computational structure prediction

  • Advanced cellular imaging:

    • Super-resolution microscopy to visualize nanoscale ER membrane dynamics

    • Light-sheet microscopy for long-term live imaging with minimal photodamage

    • Correlative light and electron microscopy to link function with ultrastructure

  • Systems biology approaches:

    • Proteome-wide interaction mapping using proximity labeling (BioID, TurboID)

    • Multi-omics integration to place RTNLB11 in broader cellular networks

    • Single-cell transcriptomics to capture cell-type specific functions

How might RTNLB11 function intersect with other cellular pathways beyond immunity?

Based on known reticulon functions, RTNLB11 likely participates in multiple cellular processes:

  • Stress response pathways:

    • ER stress and unfolded protein response

    • Autophagy and selective protein degradation

    • Lipid homeostasis and membrane organization

  • Developmental processes:

    • Cell division and ER partitioning

    • Polarized growth in specialized cell types

    • Intercellular communication through plasmodesmata

  • Metabolic regulation:

    • Specialized metabolite biosynthesis requiring ER organization

    • Lipid biosynthesis and transport

    • Protein quality control pathways

When designing experiments to explore these connections, researchers should incorporate both reverse genetics approaches and unbiased screens to identify unexpected RTNLB11 functions, while considering the potential for indirect effects due to altered ER morphology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.