Recombinant Arabidopsis thaliana Reticulon-like protein B12 (RTNLB12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us in advance, and we will prioritize its development.
Synonyms
RTNLB12; At3g54120; F24B22.80; Reticulon-like protein B12; AtRTNLB12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB12
Target Protein Sequence
MSSSSDKLFNRDRTIHEILGGGIVADVMLWRKKNVSVGIVTVTIASWMVFEAFAYTIFTL ISSVLLLLLSILFLWSKSASILNRPSPPLPEFQISEAMAEEASIWLRIHVNKLLQVSHDI AMARDSELYTKVAVSLFLLSLIGSLMDFQTLCHTSVLVVMTVPAFYERYEDYIVGSIEFI CNKTRELYLRLEIWANPENKKLS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G54120

STRING: 3702.AT3G54120.1

UniGene: At.25009

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is RTNLB12 and how does it relate to other reticulon-like proteins in Arabidopsis?

RTNLB12 belongs to the reticulon-like protein family in Arabidopsis thaliana, which includes at least 21 members (RTNLB1-21). Reticulon-like proteins are characterized by a conserved reticulon homology domain (RHD) containing paired hydrophobic regions that form hairpin-like structures inserted into the endoplasmic reticulum (ER) membrane. Based on studies of related proteins like RTNLB1 and RTNLB2, RTNLB12 likely contributes to ER tubule formation and maintenance through membrane curvature generation. While RTNLB1 and RTNLB2 have been shown to interact with the FLS2 immune receptor and modulate its transport to the plasma membrane, the specific interacting partners of RTNLB12 require further investigation .

What are the key structural features of RTNLB12?

RTNLB12, like other reticulon-like proteins, contains the characteristic RHD with transmembrane domains that insert into the ER membrane. While specific data on RTNLB12 structure is limited in the provided search results, insights from RTNLB1 indicate that these proteins contain important functional regions that determine their interactions with other proteins. For instance, RTNLB1 contains a Ser-rich region in its N-terminal tail (referred to as LCR2) that is critical for interaction with the immune receptor FLS2 . When designing experiments to study RTNLB12, researchers should consider investigating whether similar structural elements exist in RTNLB12 and how they might influence its function and protein-protein interactions.

What is the optimal approach for expressing and purifying recombinant RTNLB12?

For successful expression and purification of recombinant RTNLB12, consider the following methodological approach:

  • Expression system selection: E. coli systems like BL21(DE3) work well for recombinant protein production, but membrane proteins like RTNLB12 may require eukaryotic expression systems such as yeast (P. pastoris) or insect cells (Sf9) to ensure proper folding and post-translational modifications.

  • Vector design: Incorporate appropriate affinity tags (His6, GST, or MBP) to facilitate purification while maintaining protein functionality. Consider designing constructs that exclude transmembrane domains if solubility is an issue.

  • Purification strategy: For membrane proteins like RTNLB12, use a detergent-based extraction method followed by affinity chromatography. Test multiple detergents (DDM, LDAO, or digitonin) at varying concentrations to optimize extraction efficiency while preserving protein structure.

DetergentWorking ConcentrationAdvantagesLimitations
DDM0.05-0.1%Mild, preserves activityExpensive, large micelle size
LDAO0.1-0.5%Efficient extractionCan denature some proteins
Digitonin0.2-1.0%Preserves protein complexesVariable purity, costly
  • Quality assessment: Verify purified RTNLB12 using SDS-PAGE, Western blotting, and circular dichroism to assess purity, identity, and secondary structure.

How does RTNLB12 contribute to plant immune responses compared to RTNLB1 and RTNLB2?

While specific information about RTNLB12's role in immunity is limited in the search results, we can formulate a research approach based on the documented functions of RTNLB1 and RTNLB2. Research shows that RTNLB1 and RTNLB2 modulate immune responses by regulating the trafficking of the FLS2 receptor to the plasma membrane .

To investigate RTNLB12's potential role in immunity:

  • Generate and characterize rtnlb12 knockout mutants and RTNLB12 overexpression lines.

  • Challenge these plants with pathogens and assess disease resistance phenotypes.

  • Test whether RTNLB12, like RTNLB1 and RTNLB2, affects pattern-triggered immunity (PTI) markers such as MAPK activation and defense gene expression following exposure to pathogen-associated molecular patterns (PAMPs).

  • Examine whether RTNLB12 transcript levels change in response to pathogen treatment, similar to how RTNLB1 shows a threefold increase 3 hours after flg22 elicitation in wild-type but not in fls2 mutants .

  • Investigate potential interactions between RTNLB12 and immune receptors using co-immunoprecipitation and split luciferase complementation assays as performed for RTNLB1 and FLS2 .

What protein-protein interaction networks involve RTNLB12?

To elucidate the protein-protein interaction network of RTNLB12:

  • Use protein microarray screening as performed for FLS2-RTNLB1 interactions . This approach can identify direct binding partners of RTNLB12 from thousands of candidate proteins.

  • Implement co-immunoprecipitation followed by mass spectrometry to identify RTNLB12-associated protein complexes in vivo.

  • Confirm identified interactions using orthogonal methods like split luciferase complementation assays, bimolecular fluorescence complementation, or yeast two-hybrid systems.

  • Map the domains responsible for these interactions through deletion studies. For example, similar to how the Ser-rich region (LCR2) in RTNLB1 was identified as critical for FLS2 interaction , determine which regions of RTNLB12 mediate its protein-protein interactions.

A comprehensive interaction map will provide insights into RTNLB12's functional roles within cellular pathways.

How should I analyze phenotypic data from RTNLB12 mutant studies?

When analyzing phenotypic data from RTNLB12 mutant studies, implement the following statistical approaches:

  • For continuous phenotypic variables (growth measurements, protein trafficking rates, etc.), use ANOVA for multi-factor experiments. For the 3 × 2 × 3 factorial design described earlier, a three-way ANOVA would be appropriate, allowing you to detect main effects and interactions between factors .

  • For responses measured over time, apply repeated measures ANOVA or mixed-effects models that account for the non-independence of observations.

  • When comparing gene expression between wild-type and mutant plants (e.g., after pathogen treatment), use appropriate normalization methods and statistical tests for differential expression analysis.

  • For protein localization studies, quantify fluorescence intensities or co-localization coefficients and apply appropriate statistical tests based on data distribution.

  • Visualize data using box plots, interaction plots, or heat maps depending on the experimental design and number of variables examined.

How can I formulate rigorous research questions about RTNLB12 function?

Developing well-defined research questions is essential for RTNLB12 studies. Follow the "FINERMAPS" criteria for formulating strong research questions :

  • Feasible: Ensure the question can be answered with available resources and techniques

  • Interesting: The question should stimulate intellectual curiosity and scientific debate

  • Novel: Target unexplored aspects of RTNLB12 biology rather than duplicating existing work

  • Ethical: Consider ethical implications of genetic manipulations and experimental designs

  • Relevant: Address questions that contribute meaningfully to understanding plant membrane biology

  • Manageable: Break complex questions into smaller, tractable components

For example, instead of asking "What does RTNLB12 do?", formulate more specific questions like:

"Does RTNLB12 interact with known immune receptors and affect their plasma membrane localization similar to RTNLB1 and RTNLB2?"

"How does phosphorylation of specific serine residues in RTNLB12 affect its membrane-shaping properties and protein interactions?"

What are potential solutions for low expression yields of recombinant RTNLB12?

Low expression yields of recombinant RTNLB12 represent a common challenge due to its membrane protein nature. Consider these methodological solutions:

  • Optimize codon usage for the expression host to enhance translation efficiency.

  • Test multiple expression temperatures (typically lower temperatures of 16-25°C slow protein production and may improve folding).

  • Use fusion partners known to enhance solubility, such as MBP, SUMO, or Trx tags.

  • For bacterial expression, test multiple strains specifically designed for membrane proteins, such as C41(DE3) or C43(DE3).

  • Consider cell-free expression systems that allow direct incorporation of detergents or lipids during protein synthesis.

Expression SystemAdvantagesChallengesYield Enhancement Strategies
E. coliCost-effective, rapidPoor folding of membrane proteinsLower temperature, specialized strains
YeastPost-translational modificationsLonger expression timeOptimize media, induction conditions
Insect cellsBetter folding, PTMsTechnical complexityOptimize MOI, harvest timing
Cell-freeDirect detergent incorporationCostSupplement with chaperones

How do I reconcile contradictory findings regarding RTNLB12 subcellular localization?

When faced with contradictory findings about RTNLB12 localization:

  • Critically evaluate methodologies used in different studies, including fixation protocols, expression levels, and tagging strategies.

  • Consider using multiple independent localization methods:

    • Fluorescent protein fusions observed in live cells

    • Immunolocalization with specific antibodies

    • Subcellular fractionation followed by Western blotting

    • Proximity labeling approaches (BioID or APEX)

  • Assess whether discrepancies might result from:

    • Developmental stage differences

    • Environmental conditions

    • Overexpression artifacts

    • Tag interference with localization signals

  • Perform time-course experiments to determine if RTNLB12 relocates under specific conditions, similar to how immune receptor trafficking is regulated.

  • Use super-resolution microscopy techniques to resolve fine-scale localization patterns that might be missed with conventional microscopy.

What are promising research avenues for understanding RTNLB12 in plant stress responses?

Based on the established roles of other reticulon-like proteins in Arabidopsis, several promising research directions for RTNLB12 include:

  • Investigate whether RTNLB12 expression changes under various abiotic stresses (drought, salinity, temperature) and how this affects ER morphology and stress responses.

  • Examine potential roles in unfolded protein response (UPR) signaling during ER stress.

  • Determine if RTNLB12, like RTNLB1 and RTNLB2, participates in immune receptor trafficking and whether this function extends to other types of membrane receptors involved in stress perception.

  • Explore interactions between RTNLB12 and other ER-resident proteins involved in protein quality control and secretion during stress conditions.

  • Investigate whether RTNLB12 has specialized functions in specific cell types or tissues that experience unique stress conditions.

How might high-throughput approaches advance our understanding of RTNLB12 biology?

High-throughput approaches offer powerful tools for comprehensively characterizing RTNLB12:

  • Transcriptomics: RNA-seq analysis of rtnlb12 mutants versus wild-type plants under various conditions to identify downstream regulatory networks.

  • Proteomics: Quantitative proteomics to identify changes in protein abundance and post-translational modifications in plants with altered RTNLB12 expression.

  • Interactomics: Protein microarray screening as used for FLS2-RTNLB1 to identify the full spectrum of RTNLB12 interacting partners.

  • Phenomics: High-throughput phenotyping to characterize subtle growth and developmental phenotypes in RTNLB12 mutants across multiple environmental conditions.

  • CRISPR-Cas9 screening: Systematic mutation of RTNLB12 domains combined with functional assays to map structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.