Recombinant Arabidopsis thaliana Reticulon-like protein B13 (RTNLB13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please specify them during order placement.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.

Synonyms
RTNLB13; At2g23640; F26B6.29; F27L4.17; Reticulon-like protein B13; AtRTNLB13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB13
Target Protein Sequence
MANDVTKDPTPKSDIVEDIYLWRRKKLAFSTLLVSTSTWILLSFYGFTTITIVSWIGIAV VSMIFLWGSLLRLLSKVEPELSGLEVSEEFVVETVRSCRMLMEEMVRWMFRVGAESEWFV FARTVLGFWILSRIGNLLDFHTCLFIGLVMGLTVPKLWEEYGDQIQKHLGSLKDKSKGAY NTTHEKILEMKNKLHHGTEEKVKKSE
Uniprot No.

Target Background

Gene References Into Functions
  1. The conserved amphipathic helix is a key structural element for RTN13's in vivo function. [RTN13] PMID: 27621477
  2. The length of the transmembrane domains directly correlates with RTNLB13's membrane tubulation-inducing capacity. PMID: 20969742
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the transmembrane topology of RTNLB13?

RTNLB13, like other Arabidopsis reticulon proteins, adopts a "W" topology in the ER membrane. This means both the N and C termini are located in the cytosol, as is the central loop between transmembrane domains 2 and 3. This topology has been experimentally determined using multiple complementary approaches .

The topology was confirmed through three independent methods:

  • Redox-sensitive GFP (roGFP2) analysis

  • Protease protection assays

  • Bimolecular fluorescence complementation (BiFC)

The experimental validation aligns with TOPCONS prediction software results, which indicated that all 21 Arabidopsis RTN genes share this W topology. This arrangement is functionally significant as it allows the protein to form wedge-like structures that induce and stabilize membrane curvature in the ER .

How does RTNLB13 contribute to ER remodeling?

RTNLB13 plays a significant role in shaping the tubular ER network through its ability to induce membrane curvature. When expressed in plant cells, RTNLB13 can constrict ER tubules, demonstrating its direct involvement in ER morphology regulation .

Methodologically, this can be studied through:

  • Transient expression of fluorescent protein-tagged RTNLB13 in tobacco epidermal cells via agroinfiltration

  • Co-expression with ER markers such as GFP-HDEL

  • Confocal microscopy to visualize ER network changes

Experiments have shown that both untagged and YFP-tagged RTNLB13 overexpression results in constriction of ER tubules, indicating that the protein's role in membrane shaping is maintained regardless of the tag presence .

Interestingly, RTNLB13 may work cooperatively with other proteins like ROOT HAIR DEFECTIVE 3 (RHD3) to facilitate ER network alterations. RHD3 appears to require functional RTNLB13 to effectively modify the ER network structure .

What are the key structural domains of RTNLB13?

RTNLB13 contains several key structural domains typical of reticulon proteins:

  • Reticulon Homology Domain (RHD) - The characteristic feature of all reticulons, containing:

    • Two large hydrophobic regions that form paired transmembrane domains

    • A connecting loop region (located in the cytosol)

  • N and C terminal regions (both facing the cytosol)

  • C-terminal ER retrieval motif - In many Arabidopsis RTN isoforms, including RTNLB13, a dilysine motif (KKXX) is present, though experimental evidence suggests this motif is not essential for ER retention in RTNLB13 .

Experimental evidence shows that deletion of the C-terminal KKSE motif in RTNLB13 (ΔKKSE mutant) still results in proper ER localization and maintains the ability to constrict the ER lumen, demonstrating that this motif is not critical for ER retention .

What methods are most effective for studying RTNLB13 localization in plant cells?

Several complementary approaches can be used to study RTNLB13 localization:

  • Fluorescent protein tagging:

    • Generate N- and C-terminal fusions of RTNLB13 with fluorescent proteins (YFP, GFP)

    • Express constructs transiently in tobacco epidermal cells via agroinfiltration

    • This method provides high transformation efficiency and has been successfully used to characterize RTNLB13

  • Co-localization studies:

    • Co-express RTNLB13 fluorescent fusions with established organelle markers (e.g., GFP-HDEL for ER)

    • Analyze using confocal microscopy

    • This confirms subcellular localization and reveals effects on organelle morphology

  • Topology analysis methods:

    • Redox-sensitive GFP (roGFP2) analysis - to determine which protein domains face which cellular compartments

    • Protease protection assays - to identify domains accessible to proteases

    • Bimolecular fluorescence complementation (BiFC) - to verify topology through tagged protein fragment interaction

When designing localization experiments, it's crucial to test both N- and C-terminal fusions, as the tag position may affect protein function or localization. Additionally, verification of expression levels through Western blotting helps ensure that observed phenotypes aren't artifacts of extreme overexpression.

How can I generate recombinant RTNLB13 for experimental studies?

The generation of recombinant RTNLB13 for experimental studies follows these methodological steps:

  • Gene cloning approach:

    • Amplify the RTNLB13 coding sequence from Arabidopsis seedling cDNA using gene-specific primers

    • Clone into appropriate expression vectors (plant expression, bacterial expression, or yeast systems depending on the experimental goal)

  • For plant expression:

    • Use binary vectors suitable for Agrobacterium-mediated transformation

    • For fluorescent tagging, clone RTNLB13 in-frame with fluorescent protein sequences

    • Consider both N- and C-terminal fusion constructs to account for possible interference with protein function

  • Expression systems:

    • For studying localization and function in planta: Transient expression in tobacco leaves via agroinfiltration

    • For protein-protein interaction studies: Yeast two-hybrid system

    • For biochemical assays: E. coli or insect cell expression systems

  • Protein purification considerations:

    • As a membrane protein, RTNLB13 requires detergent solubilization

    • Affinity tags (His, GST, MBP) can facilitate purification

    • Validate protein identity by mass spectrometry or Western blotting

When designing recombinant RTNLB13 constructs, researchers should consider that modifications to the protein (truncations, mutations, or fusions) may affect its membrane integration, topology, or function. For instance, studies have shown that truncated versions containing just the first two transmembrane domains are sufficient for ER localization, which can be useful for structure-function analysis .

What experimental approaches can validate the membrane topology of RTNLB13?

Determining the correct membrane topology of RTNLB13 requires multiple complementary techniques:

  • Computational prediction:

    • Use topology prediction software like TOPCONS as a starting point

    • These tools predict transmembrane domains and their orientation

  • Redox-sensitive GFP (roGFP2) analysis:

    • Fuse roGFP2 to different domains of RTNLB13

    • The fluorescence properties of roGFP2 differ depending on whether it's in a reducing or oxidizing environment

    • This allows discrimination between cytosolic (reducing) and ER lumen (oxidizing) localization

  • Protease protection assays:

    • Isolate microsomes containing the expressed protein

    • Treat with proteases with or without membrane permeabilization

    • Analyze which domains are protected from or susceptible to proteolytic digestion

    • This identifies which portions of the protein are exposed to the cytosol versus protected in the ER lumen

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse complementary halves of a fluorescent protein to RTNLB13 domains and to markers known to localize to either the cytosol or ER lumen

    • Fluorescence will only be reconstituted if both fragments are in the same cellular compartment

    • This approach confirmed that the RHD loop of RTNLB13 is located in the cytosol

Using the combination of these approaches, researchers have confirmed that RTNLB13 adopts a "W" topology with both N and C termini in the cytosol, and the central loop between transmembrane domains 2 and 3 also in the cytosol—consistent with the topology of other reticulon family members .

How does RTNLB13 interact with other reticulon family members?

RTNLB13 demonstrates specific interaction patterns with other members of the reticulon family, which contributes to its biological function:

  • Interaction network:

    • Studies have shown that RTNLB13 can work together with other reticulon family members (RTNLB1-4) to facilitate ER tubular structure formation

    • These interactions likely enable the coordinated shaping of the ER network

  • Methodological approaches to study interactions:

    • Yeast two-hybrid assays - to detect protein-protein interactions in a heterologous system

    • In vitro pull-down assays - to confirm direct physical interactions

    • BiFC in plant cells - to visualize interactions in their native cellular context

  • Functional significance:

    • The ability of multiple reticulon proteins to interact suggests redundancy in function

    • It may explain why single reticulon mutants often show mild phenotypes

    • Coordinated action of multiple reticulons likely enhances their membrane-shaping capacity

While specific interaction data for RTNLB13 with all other family members is not detailed in the search results, the pattern observed for other reticulons (RTNLB1-4) suggests a complex interaction network. For instance, RTNLB1-4 can interact with each other to help with ER tubular structure formation, and RTNLB13 has been shown to participate in this network .

What role does RTNLB13 play in plant-pathogen interactions?

Although the search results don't specifically detail RTNLB13's role in plant-pathogen interactions, we can draw insights from studies of related reticulon proteins:

  • Agrobacterium tumefaciens infection:

    • Several reticulon proteins (RTNLB1, 2, 4, and 8) interact with the Agrobacterium VirB2 protein, a component of the Type IV secretion system

    • Overexpression of RTNLB3 or RTNLB8 enhanced plant susceptibility to A. tumefaciens transformation

    • The mechanism may involve altering ER structure or trafficking pathways important for plant defense

  • Pseudomonas syringae susceptibility:

    • Overexpression of RTNLB3 or RTNLB8 increased plant susceptibility to Pseudomonas syringae infection

    • Plants overexpressing these reticulons showed more severe disease symptoms and cell death

    • This suggests reticulons may regulate immune receptor trafficking or signaling

  • Possible mechanisms:

    • Reticulons may regulate export of pattern recognition receptors (PRRs) like FLS2 to the plasma membrane

    • Alterations in ER structure could affect secretory pathways important for immune response

    • Reticulons might directly interact with pathogen effectors or host defense components

Based on the functional similarities within the reticulon family, RTNLB13 might play comparable roles in plant-pathogen interactions, potentially affecting the trafficking of immune receptors or the structural reorganization of the ER during pathogen challenge. Further specific studies on RTNLB13 would be needed to confirm this hypothesis.

How can RTNLB13 be used as a tool to study ER dynamics?

RTNLB13 has several attributes that make it an excellent tool for studying ER dynamics:

  • ER morphology manipulation:

    • Overexpression of RTNLB13 induces constriction of ER tubules

    • This property can be leveraged to study how changes in ER morphology affect various cellular processes

    • Researchers can use inducible expression systems to control the timing and extent of ER remodeling

  • ER subdomain marking:

    • Fluorescently tagged RTNLB13 specifically labels the tubular ER network

    • This allows for real-time visualization of ER tubule dynamics

    • RTNLB13 can be used in combination with other markers to study the relationship between different ER domains

  • Structure-function analysis:

    • Various truncation constructs of RTNLB13 can help define minimal requirements for ER shaping

    • For example, studies have shown that even the first two transmembrane domains are sufficient for ER localization

    • Mutation of key residues can reveal specific amino acids important for membrane curvature

  • Experimental design considerations:

    • Use photo-activatable or photo-convertible fluorescent protein fusions with RTNLB13 for pulse-chase experiments

    • Employ super-resolution microscopy techniques to visualize fine ER structural details

    • Combine with electron microscopy to correlate fluorescence patterns with ultrastructural features

The ability of RTNLB13 to markedly alter ER morphology when overexpressed makes it particularly useful for studying how ER structure relates to function, including protein trafficking, lipid metabolism, and stress responses.

What can mutations in RTNLB13 reveal about reticulon function?

Strategic mutations in RTNLB13 can provide critical insights into reticulon function:

For instance, the finding that the first large hydrophobic region (first two predicted transmembrane domains) alone is sufficient for ER residence demonstrates that reticulons may employ alternative mechanisms for ER retention beyond the canonical KKXX motif . This suggests membrane integration itself may be a primary determinant of localization for these proteins.

How does RTNLB13 compare to other reticulon family members in Arabidopsis?

Arabidopsis contains 21 reticulon-like proteins (RTNLBs), and understanding the similarities and differences between RTNLB13 and other family members provides context for its specific functions:

  • Structural comparisons:

    • All 21 Arabidopsis RTNLBs are predicted to share the same W topology (N and C termini in the cytosol)

    • RTNLBs 1-8 belong to Group I proteins, containing an N-terminal domain with 43-93 amino acid residues and a short C-terminal domain

    • RTNLB13 has been experimentally confirmed to have this topology, validating the predictions for the family

  • Functional similarities:

    • Multiple RTNLBs (RTNLB1-4 and 13) induce constriction of ER tubules when overexpressed

    • Several family members work together in ER tubular structure formation

    • This suggests functional redundancy among family members

  • Interaction patterns:

    • Various RTNLBs show differential interaction patterns with each other:

    • RTNLB1, 2, and 4 can interact with each other and with themselves

    • RTNLB3 interacts with RTNLB2, 4, and 8 but not with itself or RTNLB5-7

    • RTNLB8 interacts with VirB2 from Agrobacterium tumefaciens

  • ER retention mechanisms:

    • Studies on RTNLB13 revealed that the C-terminal dilysine motif (KKSE) is not essential for ER retention

    • For RTNLB1-4, the first two transmembrane domains are sufficient for ER localization

    • This suggests a common alternative mechanism for ER retention across the family

This comparative analysis reveals that while RTNLBs share core structural and functional features, they likely have evolved specific interaction patterns and possibly specialized functions. RTNLB13 serves as an important model for understanding the fundamental properties shared across this protein family.

What is known about the evolutionary conservation of RTNLB13 across plant species?

While the search results don't provide specific information about the evolutionary conservation of RTNLB13 across different plant species, we can make some inferences based on what is known about reticulon proteins:

  • General reticulon conservation:

    • Reticulon proteins are found across eukaryotes, including animals, plants, and fungi

    • The reticulon homology domain (RHD) is particularly well-conserved

    • The membrane topology (W shape) appears to be a fundamental feature of reticulons across species

  • Experimental approaches to study conservation:

    • Sequence alignment analysis to identify conserved residues

    • Phylogenetic studies to determine evolutionary relationships

    • Heterologous expression experiments to test functional conservation

  • Structural vs. functional conservation:

    • The core structural features that enable membrane shaping are likely conserved

    • Species-specific variations may relate to specialized functions in different plant lineages

    • Plant-specific reticulons may have evolved unique roles compared to animal reticulons

The experimental work showing that the topology of Arabidopsis RTNLB13 matches that determined for mammalian Rtn4c from rat suggests conservation of fundamental structural features across distant eukaryotic lineages . This implies that the basic membrane-shaping mechanism of reticulons represents an ancient and conserved solution to generating ER tubules.

For researchers interested in evolutionary aspects, comparing RTNLB13 orthologs across diverse plant species could reveal which domains are under stronger evolutionary constraint, potentially identifying the most functionally critical regions of the protein.

What are the key considerations for experimental design when studying RTNLB13?

When designing experiments to study RTNLB13, researchers should consider several critical factors:

  • Expression system selection:

    • Transient expression in tobacco epidermal cells via agroinfiltration provides extremely high transformation efficiency and has been successfully used to characterize RTNLB13

    • Stable transgenic Arabidopsis lines allow for whole-plant and developmental studies

    • Heterologous systems (yeast, bacteria) may be useful for specific biochemical assays but may lack plant-specific factors

  • Protein tagging strategy:

    • Test both N- and C-terminal fluorescent protein fusions, as tag position may affect function

    • Consider small epitope tags (HA, FLAG, MYC) for experiments where larger fluorescent proteins might interfere

    • Validate that tagged proteins retain normal localization and function

  • Controls and validation:

    • Include untagged versions to confirm that observed phenotypes aren't tag artifacts

    • Use well-characterized ER markers (e.g., GFP-HDEL) for co-localization studies

    • Validate expression levels by Western blotting to ensure observations aren't due to extreme overexpression

  • Experimental variables:

    VariableConsiderationsImpact on Results
    Expression levelWeak vs. strong promotersMay affect degree of ER remodeling
    Plant tissue typeLeaf vs. root cellsTissue-specific ER organization
    Plant developmental stageSeedling vs. matureMay reveal stage-specific functions
    Environmental conditionsStress vs. normal growthCan reveal condition-dependent roles
  • Methodological approach based on research question:

    • For topology studies: Use complementary methods (roGFP2, protease protection, BiFC)

    • For interaction studies: Combine in vitro (pull-down) and in vivo (BiFC, FRET) approaches

    • For functional studies: Generate loss-of-function mutants and analyze phenotypes

Following the experimental design guidelines from established studies (search result ) is critical for generating reliable and reproducible data. This includes proper control of extraneous variables, random assignment of subjects when applicable, and precise measurement of dependent variables.

How can contradictory results in RTNLB research be reconciled?

When facing contradictory results in RTNLB research, several methodological approaches can help reconcile the differences:

  • Experimental context analysis:

    • Different expression systems may yield different results

    • Protein tag type and position can significantly impact function

    • Environmental conditions may affect protein behavior

    • Expression levels can lead to artifacts or different phenotypes

  • Contradictions in protein-protein interactions:

    • The search results indicate cases where interaction results aren't reciprocal in yeast two-hybrid tests

    • For example, RTNLB2 (bait) interacted with RTNLB8 (prey), but RTNLB8 (bait) did not interact with RTNLB2 (prey)

    • This may be explained by different conformations of bait and prey fusion proteins

    • Resolution approach: Use multiple complementary interaction methods (co-IP, in vitro pull-down, BiFC in planta)

  • Reconciliation strategies:

    • Reproduce experiments under identical conditions

    • Systematically vary one parameter at a time to identify critical variables

    • Use multiple methodologies to verify key findings

    • Collaborate with labs reporting different results

  • Common sources of contradictions and solutions:

    Source of ContradictionPotential CauseResolution Approach
    Different interaction resultsFusion protein conformationTest multiple constructs with different tag positions
    Variable phenotypesExpression level differencesQuantify protein levels alongside phenotypic analysis
    Localization discrepanciesCell type or developmental effectsCompare results across tissues and developmental stages
    Functional redundancy maskingGenetic background differencesUse higher-order mutants of related reticulons

The yeast two-hybrid example from the search results highlights that protein conformation in different fusion constructs can significantly affect interaction detection, emphasizing the importance of using complementary approaches when studying protein-protein interactions of membrane proteins like reticulons.

What are promising research directions for understanding RTNLB13 function?

Based on current knowledge of RTNLB13 and related reticulon proteins, several promising research directions emerge:

  • Structure-function relationships:

    • Detailed structural analysis of how RTNLB13 induces membrane curvature

    • Identification of specific amino acid residues critical for function

    • Cryo-electron microscopy studies of RTNLB13 oligomers in membranes

  • Role in plant immunity:

    • Investigation of RTNLB13's potential role in plant-pathogen interactions, given the demonstrated roles of other reticulons (RTNLB3, RTNLB8) in susceptibility to bacterial pathogens

    • Analysis of possible interactions with immune receptors or their trafficking pathways

    • Effect of RTNLB13 on the secretion of antimicrobial compounds during infection

  • Interaction network mapping:

    • Comprehensive identification of RTNLB13 protein interaction partners

    • Characterization of how RTNLB13 interfaces with other ER-shaping proteins

    • Investigation of potential interaction with RHD3, which requires functional RTNLB13 for ER network alteration

  • Developmental regulation:

    • Analysis of RTNLB13 expression patterns throughout plant development

    • Investigation of tissue-specific functions

    • Examination of how RTNLB13 contributes to ER remodeling during cell differentiation

  • Stress response involvement:

    • Study of RTNLB13's role during ER stress and unfolded protein response

    • Investigation of potential functions during abiotic stresses

    • Analysis of RTNLB13 regulation under different environmental conditions

  • Applied biotechnology:

    • Exploration of RTNLB13 as a tool for modifying ER structure in crop plants

    • Investigation of potential applications in improving plant resilience

    • Development of RTNLB13-based biosensors for ER dynamics

These research directions would benefit from the application of emerging technologies such as CRISPR-Cas9 gene editing for precise modification of RTNLB13, advanced super-resolution microscopy for detailed visualization of ER dynamics, and proteomics approaches to identify interaction partners under various conditions.

How might CRISPR-Cas9 technology be applied to study RTNLB13 function?

CRISPR-Cas9 technology offers powerful approaches to investigate RTNLB13 function with unprecedented precision:

This technology would be particularly valuable for creating an allelic series of RTNLB13 variants to systematically dissect how different structural features contribute to its function in ER remodeling, potentially revealing new insights about membrane protein topology and ER morphogenesis.

What are the key takeaways about RTNLB13 for researchers?

The key takeaways about RTNLB13 for researchers entering this field include:

  • Fundamental characteristics:

    • RTNLB13 is part of the 21-member reticulon-like protein family in Arabidopsis

    • It adopts a "W" topology in the ER membrane with both N and C termini in the cytosol

    • RTNLB13 plays a critical role in shaping the tubular ER network through its ability to induce membrane curvature

  • Experimental considerations:

    • Multiple complementary approaches (roGFP2, protease protection, BiFC) are needed to accurately determine membrane topology

    • Transient expression in tobacco provides an excellent system for studying RTNLB13 localization and function

    • Both N- and C-terminal tags should be tested when creating fusion proteins

  • Functional insights:

    • The C-terminal dilysine motif (KKSE) is not essential for ER retention of RTNLB13

    • The first two transmembrane domains alone are sufficient for ER localization

    • RTNLB13 works cooperatively with other proteins like RHD3 in ER network formation

  • Biological significance:

    • Reticulon proteins can interact with each other to form complexes that enhance membrane curvature

    • Some reticulons play roles in plant-pathogen interactions, suggesting RTNLB13 might have similar functions

    • The family shows potential functional redundancy, requiring careful experimental design to reveal specific roles

These insights provide a solid foundation for researchers studying RTNLB13 and suggest that this protein serves as an excellent model for understanding how membrane proteins shape organelles and contribute to cellular organization in plants.

How does understanding RTNLB13 contribute to broader plant cell biology knowledge?

Research on RTNLB13 contributes significantly to broader understanding of plant cell biology in several ways:

  • ER organization principles:

    • RTNLB13 studies reveal fundamental mechanisms of how plant cells shape and maintain the tubular ER network

    • This contributes to understanding organelle biogenesis and maintenance

    • Knowledge of ER shaping mechanisms informs models of cellular compartmentalization

  • Membrane protein topology:

    • The experimental validation of RTNLB13's "W" topology provides insights into how complex membrane proteins are integrated into bilayers

    • This contributes to our understanding of membrane protein insertion and folding

    • The work highlights methodological approaches that can be applied to other membrane proteins

  • Protein retention mechanisms:

    • Finding that RTNLB13 doesn't require the canonical KKXX motif for ER retention reveals alternative mechanisms for organelle-specific localization

    • This challenges conventional understanding of protein targeting

    • Suggests membrane integration itself may serve as a localization determinant

  • Cell-pathogen interactions:

    • Related reticulons' involvement in susceptibility to Agrobacterium and Pseudomonas suggests roles in immune response regulation

    • This connects ER structure to plant defense responses

    • Highlights how cellular architecture and immunity are interconnected

  • Evolutionary insights:

    • Conservation of reticulon structure and function across eukaryotes suggests fundamental requirements for ER tubule formation

    • The expanded reticulon family in plants (21 members in Arabidopsis) implies specialized or redundant functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.