Recombinant Arabidopsis thaliana Reticulon-like protein B16 (RTNLB16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipments, which incur additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of the specified tag.
Synonyms
RTNLB16; At3g10915; F9F8.30; Reticulon-like protein B16; AtRTNLB16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB16
Target Protein Sequence
MDSLSDIDGDFDGRNEGGSSSDYRLLGRQITVHQFMGGGKAADLLLWRRRHLSLGVIIIS TVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQLHSLPELVLSEEMVNSAA ASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAIGSYISLCTLLYIGTILSVTIP ALYSKYQSKVDKCCGTIHRRLSHHYKIVDENVISRLSWSLSKDKDS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G10915

UniGene: At.44168

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is RTNLB16 and what is its general function in Arabidopsis thaliana?

RTNLB16 (Reticulon-like protein B16) belongs to the plant-specific reticulon-like protein family (RTNLBs). These membrane-spanning proteins are primarily found in the endoplasmic reticulum (ER) and are involved in various cellular functions including ER membrane morphogenesis, vesicle formation, and trafficking. The RTNLB16 gene in Arabidopsis thaliana has seven splice variants that encode seven distinct protein isoforms, suggesting complex regulatory mechanisms .

Research has demonstrated that RTNLB16 plays crucial roles in:

  • Maintaining proper ER network structure

  • Regulating growth and development

  • Mediating hormone responses, particularly to abscisic acid (ABA)

  • Contributing to stress response pathways

  • Potentially influencing reproductive development

The balanced expression of different RTNLB16 isoforms appears critical for normal cellular and physiological activities in Arabidopsis .

What are the most effective approaches for producing recombinant RTNLB16 for research purposes?

For successful recombinant RTNLB16 production, the following protocol has proven effective:

  • Expression System Selection:

    • E. coli is the preferred expression system for full-length RTNLB16 production

    • For functional studies, fusion with an N-terminal His-tag facilitates purification without significantly affecting protein structure

  • Gene Optimization and Cloning:

    • Clone the full-length cDNA (1-226 amino acids) into an appropriate expression vector

    • Consider codon optimization for E. coli if expression yields are low

  • Expression Conditions:

    • Optimize induction temperature (typically 16-25°C for membrane proteins)

    • Adjust IPTG concentration to prevent formation of inclusion bodies

    • Consider using specialized E. coli strains designed for membrane protein expression

  • Purification Protocol:

    • Use nickel affinity chromatography for His-tagged protein

    • Employ appropriate detergents for membrane protein solubilization

    • Implement size exclusion chromatography for higher purity

  • Storage Recommendations:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

    • For long-term storage, add glycerol to a final concentration of 5-50%

When reconstituting lyophilized protein, dissolve in deionized sterile water to a concentration of 0.1-1.0 mg/mL for optimal results .

How can T-DNA insertion mutants be properly characterized for RTNLB16 functional studies?

Proper characterization of T-DNA insertion mutants for RTNLB16 requires a comprehensive approach:

  • Insertion Site Verification:

    • Perform PCR-based genotyping to confirm T-DNA insertion location

    • Sequence across the insertion junction to precisely identify the affected region

    • For RTNLB16, assess if the insertion affects specific splice variants (as seen in Salk_122275/rtnlb16-1)

  • Expression Analysis:

    • Conduct RT-PCR and qRT-PCR to determine expression levels of all splice variants

    • Use primers specific to each splice variant to distinguish their expression patterns

    • Employ RNA-seq for comprehensive transcriptome analysis (as performed for rtnlb16-1)

  • Protein Analysis:

    • Perform Western blotting to confirm protein levels and variants

    • Use specific antibodies if available, or tagged versions for detection

    • Consider mass spectrometry to identify which protein isoforms are present/absent

  • Promoter Activity Assessment:

    • Be aware that T-DNA insertions may contain regulatory elements (like the 35S promoter)

    • Analyze if the insertion activates or represses nearby genes (as observed with rtnlb16-1)

    • Use promoter-reporter fusions to visualize expression patterns

  • Phenotypic Characterization Under Different Conditions:

    • Test mutant phenotypes under various conditions (e.g., different light regimes)

    • The rtnlb16-1 mutant showed photoperiod-dependent phenotypes, indicating condition-specific effects

    • Compare homozygous, heterozygous, and wild-type plants

This rigorous characterization is crucial since T-DNA insertions may create complex genetic situations, especially for genes with multiple splice variants like RTNLB16 .

What imaging techniques are most effective for studying RTNLB16 subcellular localization?

For optimal visualization of RTNLB16 subcellular localization, researchers should employ:

  • Confocal Laser Scanning Microscopy:

    • Generate RTNLB16:GFP fusion constructs under native or constitutive promoters

    • Use high-resolution confocal microscopy to visualize tubular ER networks

    • Co-localize with established ER markers (e.g., BiP, calnexin) to confirm ER localization

    • Previous studies have successfully localized RTNLB16:GFP to the tubular ER network, plasmodesmata, and potentially Golgi bodies

  • Super-Resolution Microscopy:

    • Techniques like STED or PALM/STORM for nanoscale resolution

    • Valuable for distinguishing between closely associated structures like ER-plasma membrane contact sites

  • Transmission Electron Microscopy with Immunogold Labeling:

    • Use antibodies against RTNLB16 or its tags coupled with gold particles

    • Provides ultrastructural detail of membrane association and topology

  • Live Cell Imaging:

    • Employ photoactivatable fluorescent proteins to track protein dynamics

    • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

    • Particularly useful for analyzing ER remodeling and protein dynamics

  • Multi-Channel Imaging:

    • Co-express markers for plasmodesmata, Golgi, and other organelles

    • Essential for confirming RTNLB16's presence in multiple compartments

When designing these experiments, consider that different RTNLB16 splice variants may show distinct localization patterns, requiring isoform-specific tagging strategies .

What is the relationship between RTNLB16 and hormone responses in plants?

RTNLB16 has significant interactions with plant hormone signaling pathways:

  • Abscisic Acid (ABA) Response:

    • The rtnlb16-1 mutant exhibits decreased sensitivity to ABA, a key hormone in stress responses and developmental processes

    • This suggests RTNLB16 plays a positive regulatory role in ABA signaling

    • Experimental evidence: Mutants showed altered responses in germination and growth assays with exogenous ABA

  • Connection to Other Hormone Pathways:

    • Transcriptomics comparison between rtnlb16-1 and wild-type plants revealed differential gene expression in salicylic acid and jasmonic acid response pathways

    • This indicates RTNLB16 may function at the intersection of multiple hormone signaling networks

  • Mechanistic Hypotheses:

    • RTNLB16 may influence hormone receptor localization or trafficking

    • It could affect membrane properties at hormone signaling sites

    • It might directly interact with hormone signaling components

  • Methodological Approaches to Study This Relationship:

    • Hormone sensitivity assays comparing wild-type and mutant plants

    • Co-localization studies with hormone receptors and signaling components

    • Protein-protein interaction studies to identify direct connections to signaling pathways

    • Analysis of membrane properties in regions associated with hormone signaling

  • Senescence Regulation:

    • The rtnlb16-1 mutant showed enhanced tolerance to darkness-induced senescence

    • This suggests RTNLB16 normally functions in senescence progression, possibly through hormone-dependent mechanisms

The ER serves as a central hub for integrating signals from biotic and abiotic stress responses, and RTNLB16 appears to play a crucial role in coordinating these responses through hormone signaling networks .

What are the key considerations when designing experiments to study RTNLB16 function?

When investigating RTNLB16 function, researchers should carefully consider:

  • Genetic Material Selection:

    • Use multiple independent T-DNA insertion lines when possible

    • Be aware that T-DNA insertions may cause complex genetic situations (e.g., knockout of one splice form while increasing expression of others)

    • Consider complementation with specific splice variants to dissect their individual functions

  • Environmental Conditions:

    • The rtnlb16-1 phenotype varies dramatically under different light conditions

    • Test phenotypes under multiple growth conditions: long day (16:8h), continuous low-light, and other relevant environmental variables

    • Document all environmental parameters precisely for reproducibility

  • Controls and Comparisons:

    • Include wild-type, heterozygous, and homozygous plants in experiments

    • Use both negative and positive controls for physiological assays

    • Consider the non-Mendelian inheritance patterns observed in RTNLB16/rtnlb16 heterozygotes

  • Phenotypic Analysis Breadth:

    • Assess growth parameters (height, leaf area, chlorophyll content)

    • Examine developmental timing (germination, flowering, senescence)

    • Test responses to multiple hormones and stresses

    • Evaluate reproductive development and fertility

  • Molecular Analysis Approaches:

    • Conduct transcriptomics under different conditions to capture condition-specific responses

    • Use proteomics to identify interaction partners

    • Perform structural studies to understand membrane interaction mechanisms

  • Statistical Design:

    • Ensure sufficient biological and technical replicates

    • Use appropriate statistical tests for data analysis

    • Consider factorial experimental designs to assess interactions between variables

When publishing, researchers should share detailed methodologies, including growth conditions, primer sequences, and analysis parameters, as these factors significantly impact RTNLB16-related phenotypes 4.

How can transcriptomic analysis be optimized to understand RTNLB16's role in plant physiology?

For optimal transcriptomic analysis of RTNLB16 function:

  • Experimental Design Considerations:

    • Compare multiple genotypes: wild-type, RTNLB16 knockout, and specific splice variant complementation lines

    • Include different environmental conditions that affect phenotype severity (e.g., different light regimes)

    • Collect samples at multiple developmental stages or time points after treatment

  • Sample Preparation Optimization:

    • Use tissue-specific sampling when possible

    • Minimize batch effects by processing all comparable samples together

    • Extract high-quality RNA with methods optimized for plant tissues

  • Sequencing Approach:

    • Use stranded RNA-seq to distinguish sense and antisense transcription

    • Include sufficient sequencing depth to detect low-abundance transcripts

    • Consider long-read sequencing to better characterize splice variants

  • Data Analysis Strategy:

    • Employ Integrated Genomics Viewer (IGV) to analyze read distribution across the RTNLB16 locus

    • This approach successfully revealed T-DNA effects on RTNLB16 expression in previous research

    • Use specialized tools for differential isoform expression analysis

    • Perform Gene Ontology and pathway enrichment analyses

  • Validation Approaches:

    • Confirm key findings with qRT-PCR

    • Validate protein-level changes with Western blotting

    • Test functional hypotheses derived from transcriptomic data with targeted assays

  • Integration with Other Data Types:

    • Combine transcriptomics with proteomic or metabolomic data

    • Correlate expression changes with phenotypic observations

    • Use publicly available data to compare with other stress responses

Previous research successfully employed RNA-seq to compare rtnlb16-1 and wild-type plants under continuous low-light and long-day conditions, revealing differential gene expression in hormone response pathways that explained the observed phenotypes .

What are common challenges in studying proteins with multiple splice variants like RTNLB16?

Researchers face several technical challenges when studying proteins with multiple splice variants:

  • Genetic Manipulation Complexity:

    • T-DNA insertions may affect only specific splice variants while leaving others intact

    • As observed with rtnlb16-1, insertions can simultaneously knockout one variant while enhancing expression of others

    • Solution: Design precise CRISPR/Cas9 targeting strategies to affect all or specific variants

  • Expression Pattern Characterization:

    • Different variants may be expressed in specific tissues or developmental stages

    • Solution: Use isoform-specific primers for RT-PCR or RNA-seq with sufficient read depth and appropriate bioinformatics pipelines

  • Protein Detection Specificity:

    • Antibodies may not distinguish between highly similar isoforms

    • Solution: Design epitope tags for specific variants or use mass spectrometry approaches

  • Functional Redundancy:

    • Overlapping functions between variants can mask phenotypes

    • Solution: Create multiple knockout combinations and perform careful phenotypic analyses under various conditions

  • Data Interpretation Challenges:

    • Distinguishing primary from secondary effects when multiple pathways are affected

    • Solution: Time-course experiments and careful pathway analysis

  • Reproducibility Issues:

    • Environmental conditions can dramatically affect phenotypes of splice variant mutants

    • As seen with rtnlb16-1, phenotype severity depends on light conditions

    • Solution: Maintain strict environmental control and report all parameters

  • Interaction Network Complexity:

    • Different isoforms may interact with distinct protein partners

    • Solution: Isoform-specific protein interaction studies (Y2H, BiFC, or AP-MS approaches)

Researchers should approach the study of RTNLB16 with awareness of these challenges, designing experiments that account for splice variant complexity and potential condition-dependent effects .

How can contradictory data in RTNLB16 research be reconciled and analyzed?

When faced with contradictory data in RTNLB16 research:

  • Environmental Condition Examination:

    • The rtnlb16-1 mutant shows dramatically different phenotypes under different light conditions

    • Carefully compare experimental conditions between studies showing contradictory results

    • Recreate both conditions in parallel experiments to confirm condition-dependent effects

  • Genotype Verification:

    • Confirm the precise genetic nature of all RTNLB16 mutants used

    • Sequence the insertion site and determine which splice variants are affected

    • Check for expression levels of all variants, not just the targeted one

  • Promoter Activity Assessment:

    • T-DNA insertions may contain promoters (e.g., 35S) that affect nearby gene expression

    • In rtnlb16-1, the 35S promoter at the T-DNA left border increased expression of some RTNLB16 variants

    • Verify if similar effects occur in mutants showing contradictory phenotypes

  • Multi-method Validation:

    • Use complementary techniques to verify key findings

    • Confirm molecular phenotypes with both RNA and protein-level analyses

    • Validate interaction studies with multiple independent methods

  • Statistical Rigor:

    • Ensure sufficient replication and appropriate statistical analysis

    • Consider if contradictions might result from underpowered studies

    • Use meta-analysis approaches when multiple datasets are available

  • Developmental Timing Considerations:

    • Check if contradictory results stem from analyses at different developmental stages

    • The effect of RTNLB16 variants may change throughout plant development

  • Reconciliation Framework:

    • Develop models that encompass seemingly contradictory results

    • Consider that RTNLB16 may have context-dependent functions

    • Test these models with targeted experiments

Research on the Arabidopsis rtnlb16-1 mutant has demonstrated that seemingly contradictory phenotypes can be reconciled by understanding the complex genetics and condition-dependent nature of RTNLB16 function .

What are promising research avenues for understanding RTNLB16's role in plant stress responses?

Several promising research directions could advance our understanding of RTNLB16's role in stress responses:

  • Mechanistic Analysis of Hormone Crosstalk:

    • Investigate how RTNLB16 mediates interactions between ABA, salicylic acid, and jasmonic acid pathways

    • Determine if specific splice variants regulate distinct hormone pathways

    • Study how RTNLB16 influences hormone receptor localization or endocytosis

  • Structural Biology Approaches:

    • Resolve the membrane topology of different RTNLB16 variants

    • Examine how these structures influence ER membrane curvature

    • Investigate structure-function relationships in different cellular compartments

  • Systems Biology Integration:

    • Develop network models incorporating RTNLB16 variants and their interaction partners

    • Use multi-omics approaches to understand system-wide effects of RTNLB16 perturbation

    • Apply mathematical modeling to predict RTNLB16 behavior under various stress conditions

  • Evolutionary Analysis:

    • Compare RTNLB16 structure and function across plant species

    • Investigate if splice variant diversity varies with evolutionary adaptation to different environments

    • Determine if RTNLB16's role in stress response is conserved across species

  • Advanced Imaging Applications:

    • Use super-resolution microscopy to examine RTNLB16's role in organizing membrane microdomains

    • Employ FRET/FLIM to study dynamic interactions during stress responses

    • Develop biosensors to monitor RTNLB16 activity in real-time

  • Translational Research:

    • Explore if modifying RTNLB16 expression or structure can enhance stress tolerance

    • Investigate potential applications in improving crop resilience to environmental stresses

    • Develop screening methods to identify chemicals that modify RTNLB16 function

Transcriptomic analysis has already revealed that disruption of RTNLB16 expression affects genes involved in biotic and abiotic stress responses, suggesting it plays a crucial role in the ER's function as a central hub for integrating stress signals .

How might CRISPR/Cas9 technology advance our understanding of RTNLB16 splice variant functions?

CRISPR/Cas9 technology offers powerful approaches for dissecting RTNLB16 splice variant functions:

  • Precise Isoform-Specific Knockouts:

    • Design gRNAs targeting unique exons of specific splice variants

    • Create a library of plants lacking individual or combinations of RTNLB16 isoforms

    • This overcomes limitations of T-DNA insertions that often affect multiple variants simultaneously

  • Domain-Specific Modifications:

    • Use base editing or prime editing to modify specific functional domains

    • Create point mutations in membrane-spanning regions to alter topology

    • Modify interaction interfaces without disrupting the entire protein

  • Promoter Engineering:

    • Edit promoter elements to alter expression patterns of specific variants

    • Create inducible or tissue-specific expression systems

    • This enables temporal and spatial control of variant expression

  • Tagging Endogenous Loci:

    • Insert fluorescent protein tags at the endogenous locus

    • Create variant-specific tags to track individual isoforms

    • Maintain native expression levels and patterns while enabling visualization

  • Experimental Design Considerations:

    • Generate multiple independent lines for each modification

    • Include appropriate controls (e.g., non-edited siblings)

    • Verify edits by sequencing and expression analysis

    • Test phenotypes under multiple environmental conditions, as RTNLB16 function is condition-dependent

  • Multi-level Analysis:

    • Combine CRISPR/Cas9 editing with RNA-seq, proteomics, and metabolomics

    • Perform comparative phenotypic analysis across variants

    • Use microscopy to examine subcellular localization of each variant

These approaches would significantly advance our understanding beyond what was possible with traditional T-DNA insertion mutants, which created complex genetic situations as seen in the rtnlb16-1 mutant .

RTNLB16 Expression Data Under Different Conditions

ConditionWild-type RTNLB16 Expressionrtnlb16-1 RTNLB16 ExpressionPhenotypic Effect in rtnlb16-1
Long Day (16:8h)Baseline levelsSignificantly elevated (all isoforms except isoform 7)Severe growth inhibition, reduced chlorophyll
Continuous Low LightBaseline levelsModerately elevatedSignificantly mitigated growth defects
ABA TreatmentResponsiveLess responsiveDecreased sensitivity to ABA
Darkness-induced SenescenceNormal senescence progressionLess affectedEnhanced tolerance to senescence

Note: Data compiled from transcriptomic analysis comparing wild-type and rtnlb16-1 under different light conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.