Recombinant Arabidopsis thaliana Reticulon-like protein B18 (RTNLB18)

Shipped with Ice Packs
In Stock

Description

Key Mechanisms

  1. Endoplasmic Reticulum (ER) Retention: Overexpression of RTNLB1 retains FLS2 in the ER, impairing its transport to the plasma membrane and reducing pathogen signaling .

  2. Serine-Rich Regions: A 30-residue Ser-rich region in RTNLB1’s N-terminal tail is critical for FLS2 binding. Phosphorylation at Ser-61 modulates immune responses .

  3. Tyrosine-Dependent Sorting Motifs (TDMs): Two TDMs in RTNLB1 mediate receptor sorting. Deleting these motifs partially reverses ER retention effects .

HomologFunctionRelevance to RTNLB18
RTNLB1Traffics FLS2 to plasma membrane; required for pathogen-triggered immunityPotential conserved role
RTNLB2Redundant with RTNLB1; involved in EFR (Elicitor Peptide Receptor) signalingShared trafficking pathways

Production Challenges

Recombinant RTNLB18 faces hurdles common to full-length membrane proteins:

  • Hydrophobicity: Requires optimization of codon usage and expression vectors .

  • Proteolysis: Susceptibility to degradation necessitates protease inhibitors during purification .

Applications

Use CaseDetailsSource
ImmunoassaysELISA kits for detecting RTNLB18 in plant extracts or recombinant systems
Structural StudiesX-ray crystallography or cryo-EM to resolve membrane topology
Functional ScreensTesting interactions with receptors (e.g., FLS2, EFR) in Arabidopsis

Research Gaps and Future Directions

  1. Functional Studies: Direct evidence for RTNLB18’s role in receptor trafficking or membrane organization remains uncharacterized.

  2. Genetic Diversity: Arabidopsis genome studies reveal significant centromeric variation, but RTNLB18’s genetic polymorphism is unexplored .

  3. Therapeutic Potential: While RTNLB1/2 homologs in animals (e.g., Nogo) inhibit axon growth, RTNLB18’s role in plant immunity could inspire biotechnological applications (e.g., pathogen resistance).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
RTNLB18; At4g28430; F20O9.110; Reticulon-like protein B18; AtRTNLB18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB18
Target Protein Sequence
MDSTTTPPSLRSNTRSALRLARNNKTLVKSHIPSLDLVLLSPKNNNGTPYPSPVSLSSPS SPVTLREILLLSPSPLRKSRTRLSNRFDMEAAEAAVTARRSKTKGGQNGLLASPSPRNFR RSRLRSEAMVDTKENTEPIVVVTDEKKQNQRKQKKLGRSKKEKHSSVPLLASPSPSSDQP QDVCQGDLERIRENISDLIMWRDVAKSTLWFGFGCICFLSTCFAAKGFNFSVFSAISYLG LLFLGVSFLSNTLRQRVTEEARRELKLSEDDVLRIARRMLPITNLAISKTSELFSGEPAM TLKVAPFVLMGAEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAW GVCTHKKFVAGSAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDSEDEEEKKQQEKT HPEQQKSPEDKSTSPRSAEEEQALVLVAETKAPKKLY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G28430

UniGene: At.32015

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Arabidopsis thaliana Reticulon-like protein B18 (RTNLB18)?

RTNLB18 belongs to the reticulon-like protein family in Arabidopsis thaliana, which contains approximately 21 members. As with other reticulon proteins, RTNLB18 likely plays crucial roles in shaping the endoplasmic reticulum (ER) and potentially in protein trafficking processes. The recombinant form refers to the protein expressed using heterologous systems for research purposes.

Based on studies of related reticulon proteins such as RTNLB1 and RTNLB2, RTNLB18 likely contains a reticulon homology domain (RHD) with transmembrane regions that insert into the ER membrane. Related reticulon-like proteins have been shown to interact with immune receptors like FLS2 (FLAGELLIN SENSING 2) and affect their intracellular trafficking, influencing plant immune responses .

How does RTNLB18 compare structurally to other characterized reticulon proteins in Arabidopsis?

While specific structural data for RTNLB18 is emerging, we can infer its likely structural characteristics based on conserved features of the reticulon protein family:

Domain/FeatureTypical LocationProposed FunctionConservation Across RTNLBs
Reticulon Homology Domain (RHD)C-terminusMembrane curvatureHighly conserved
Transmembrane domainsWithin RHDER membrane insertionConserved
Hydrophilic loopBetween TM domainsProtein interactionsVariable
N-terminal regionN-terminusSpecific interactionsHighly variable

In related reticulon proteins like RTNLB1, a Serine-rich region in the N-terminal tail is critical for interactions with immune receptors such as FLS2 . Similar functional domains in RTNLB18 may mediate specific protein-protein interactions relevant to its biological role.

What expression patterns does RTNLB18 show across different tissues and developmental stages?

Understanding RTNLB18 expression patterns requires multiple complementary approaches:

  • Quantitative RT-PCR to measure transcript levels across various tissues

  • Promoter-reporter gene fusions (RTNLB18pro:GUS) for histochemical visualization

  • RNA-seq data analysis to examine expression across developmental stages

  • Western blotting with RTNLB18-specific antibodies to assess protein abundance

Similar to other reticulon proteins, RTNLB18 expression is likely developmentally regulated and responsive to environmental stimuli. For context, RTNLB1 transcript levels increase approximately threefold following treatment with the bacterial flagellin peptide flg22, suggesting a role in plant immunity .

What techniques are most effective for purifying recombinant RTNLB18?

Purifying membrane proteins like RTNLB18 presents significant challenges due to their hydrophobic nature. Effective methodological approaches include:

  • Expression system optimization:

    • Bacterial systems (E. coli BL21(DE3), C41, C43 strains)

    • Eukaryotic systems (P. pastoris, insect cells) for proper folding

    • Cell-free expression systems to avoid toxicity issues

  • Fusion tags and constructs:

    • N-terminal vs. C-terminal tag placement (considering topology)

    • Maltose-binding protein (MBP) tag for enhanced solubility

    • Twin-Strep-tag or His-tag for affinity purification

    • TEV protease cleavage site for tag removal

  • Extraction and solubilization protocol:

    DetergentCMC (mM)Recommended ConcentrationMembrane Protein Applications
    DDM0.171-2%Mild extraction, maintains function
    LMNG0.010.1-1%Enhanced stability
    Digitonin0.50.5-2%Native complex preservation
    SMA polymerN/A2.5%Detergent-free extraction
  • Chromatographic methods:

    • IMAC (Immobilized Metal Affinity Chromatography)

    • Size exclusion chromatography

    • Ion exchange chromatography

The optimal purification strategy should be determined through small-scale expression and solubility tests before scaling up for functional studies .

How can researchers effectively generate and characterize RTNLB18 knockout and overexpression lines?

Creating and validating modified RTNLB18 expression lines involves:

  • Knockout strategies:

    • T-DNA insertion mutants from stock centers

    • CRISPR/Cas9-mediated gene editing targeting conserved regions

    • Verification of knockout by RT-PCR, qPCR, and Western blotting

  • Overexpression approaches:

    • 35S promoter for constitutive expression

    • Native promoter with multiple enhancer elements

    • Inducible systems (estrogen-inducible or dexamethasone-inducible)

  • Comprehensive phenotypic analysis:

    • ER morphology (using ER markers like HDEL-GFP)

    • Protein trafficking efficiency (using secreted reporter proteins)

    • Pathogen susceptibility tests

    • PTI marker gene expression (e.g., FRK1, NHL10)

    • MAPK activation kinetics after PAMP treatment

Studies with related reticulon proteins have shown that both knockout and overexpression can affect immune receptor trafficking and function. For example, both rtnlb1 rtnlb2 double mutants and RTNLB1 overexpression lines exhibit reduced activation of FLS2-dependent signaling and increased susceptibility to pathogens .

What methods are available to investigate RTNLB18 interactions with immune receptors?

Investigating potential roles of RTNLB18 in immunity requires specialized approaches:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation with epitope-tagged RTNLB18

    • Yeast-two-hybrid (particularly split-ubiquitin for membrane proteins)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Protein microarrays (as used to identify RTNLB1-FLS2 interaction)

  • Functional assays for immune receptor activity:

    • FLS2-dependent responses in RTNLB18 mutant backgrounds

    • Early immune responses (ROS burst, MAPK activation)

    • Defense gene expression profiles

    • Callose deposition

  • Trafficking and localization analyses:

    • Confocal microscopy with fluorescent protein fusions

    • Subcellular fractionation and immunoblotting

    • Endocytic trafficking assays with FM4-64 dye

Research with RTNLB1 and RTNLB2 demonstrated their interaction with the immune receptor FLS2 through a specific Serine-rich region. This interaction affects FLS2 accumulation at the plasma membrane and subsequent immune signaling .

How does RTNLB18 contribute to endoplasmic reticulum morphology?

Investigating RTNLB18's role in ER shaping requires advanced imaging approaches:

  • High-resolution imaging techniques:

    • Confocal microscopy with ER markers

    • Super-resolution microscopy (STED, PALM, STORM)

    • Transmission electron microscopy for ultrastructure

    • Live-cell imaging for ER dynamics

  • Quantitative analysis parameters:

    • ER tubule diameter measurements

    • Tubule-to-sheet ratio calculations

    • Network complexity metrics

    • Three-way junction frequency

  • Experimental comparisons:

    • Wild-type vs. RTNLB18 mutants

    • RTNLB18 overexpression effects

    • Double/triple mutants with other ER-shaping proteins

    • Stress-induced ER morphology changes

Reticulon proteins generally induce membrane curvature through their wedge-like insertion into the ER membrane via transmembrane domains. RTNLB18 likely contributes to tubular ER formation and maintenance, with potential impacts on processes dependent on ER morphology such as protein trafficking and quality control.

What approaches can identify regulatory mechanisms controlling RTNLB18 expression during stress responses?

Comprehensive analysis of RTNLB18 regulation requires:

  • Transcriptional regulation studies:

    • Promoter analysis and reporter constructs

    • ChIP-seq to identify transcription factor binding

    • EMSA for promoter-protein interactions

    • DNase I footprinting for protected regions

  • Post-transcriptional regulation:

    • RNA stability assays

    • Alternative splicing analysis

    • miRNA target prediction and validation

    • Polysome profiling for translation efficiency

  • Post-translational regulation:

    • Phosphoproteomics

    • Ubiquitination analysis

    • Pulse-chase experiments for protein turnover

    • Protein interaction networks under stress conditions

Other reticulon proteins show stress-responsive expression patterns. For example, RTNLB1 is induced during pattern-triggered immunity in an FLS2-dependent manner , suggesting similar regulatory mechanisms might exist for RTNLB18.

How can Advanced Intercross Recombinant Inbred Lines (AI-RILs) be utilized to map QTLs associated with RTNLB18 function?

AI-RILs provide enhanced genetic mapping resolution compared to traditional mapping populations:

  • AI-RIL advantages for RTNLB18 research:

    • Expanded genetic maps with increased recombination events

    • Higher precision QTL localization (approximately 50 kb/cM)

    • Ability to detect closely linked loci that might otherwise appear as a single QTL

    • Potential to identify epistatic interactions

  • Experimental design considerations:

    • Select AI-RIL populations with appropriate parentals (e.g., EstC, KendC)

    • Phenotype for traits potentially influenced by RTNLB18

    • Genotype using SNP markers at appropriate density

    • Apply composite interval mapping for QTL identification

  • Validation approaches:

    • Near-isogenic lines for specific QTLs

    • RTNLB18 expression analysis in diverse accessions

    • Complementation tests with candidate genes

    • Functional characterization of natural variants

The advanced intercrossing approach has been demonstrated to expand genetic maps in Arabidopsis populations, providing a powerful resource for high-precision QTL mapping that could reveal subtle effects of RTNLB18 variants on phenotypes of interest .

What are the optimal conditions for expressing RTNLB18 in heterologous systems?

Optimizing recombinant RTNLB18 expression requires systematic evaluation of multiple parameters:

  • Bacterial expression optimization:

    • Strain selection (BL21, Rosetta, Origami)

    • Codon optimization for E. coli

    • Induction conditions:

      • Temperature (16-37°C)

      • IPTG concentration (0.1-1.0 mM)

      • Induction duration (3-24h)

    • Addition of solubility enhancers (glycerol, sucrose)

  • Eukaryotic expression systems:

    • Yeast (P. pastoris, S. cerevisiae)

    • Insect cells (Sf9, High Five)

    • Plant-based expression (N. benthamiana)

  • Cell-free expression systems:

    • E. coli extract-based

    • Wheat germ extract

    • Addition of lipid nanodiscs or microsomes

  • Construct design considerations:

    • Remove signal peptides if present

    • Consider fusion partner orientation

    • Include purification tags

    • Add protease cleavage sites

Expression of membrane proteins like reticulons presents unique challenges due to their hydrophobicity and potential toxicity to host cells. Based on proteomics studies with Arabidopsis proteins, optimized low-temperature expression with specialized strains often yields better results for membrane proteins .

How can researchers accurately determine the topology of RTNLB18 in the ER membrane?

Establishing the precise membrane topology of RTNLB18 requires specialized approaches:

  • Computational prediction methods:

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Topology prediction algorithms (TopPred, MEMSAT)

    • Hydrophobicity plots

  • Experimental topology mapping techniques:

    • Protease protection assays

    • Glycosylation site mapping

    • Cysteine accessibility methods

    • GFP-fusion reporter assays

  • Structural biology approaches:

    • Cryo-electron microscopy

    • X-ray crystallography (challenging for membrane proteins)

    • NMR for specific domains

    • Cross-linking mass spectrometry

Based on studies of related reticulon proteins, RTNLB18 likely adopts a topology where both N and C termini face the cytosol, with two transmembrane domains forming a hairpin-like structure in the ER membrane. This arrangement creates wedge-like insertions that induce membrane curvature, essential for tubular ER formation.

What phylogenetic approaches best reveal evolutionary relationships between RTNLB18 and other plant reticulon proteins?

Comprehensive evolutionary analysis of RTNLB18 requires:

  • Sequence acquisition and preparation:

    • Database mining (UniProt, Phytozome, TAIR)

    • Identification of orthologs and paralogs

    • Multiple sequence alignment (MUSCLE, T-Coffee)

    • Alignment curation and refinement

  • Phylogenetic tree construction methods:

    • Maximum likelihood (RAxML, PhyML)

    • Bayesian inference (MrBayes)

    • Distance-based methods (Neighbor-Joining)

    • Character-based methods (Maximum Parsimony)

  • Selection analysis:

    • dN/dS ratio calculation

    • Site-specific selection models

    • Branch-site models for lineage-specific selection

    • Identification of conserved functional motifs

Analysis LevelRecommended MethodsExpected Insights
Within RTNLB familyMaximum likelihood, synteny analysisRecent duplication events
Across plant speciesBayesian inference, reconciliation with species treeOrthology relationships
Across eukaryotesHMM profiles, structural comparisonsAncient functional domains

The expanded reticulon family in Arabidopsis (21 members) compared to other organisms suggests gene duplication events have led to diversification and potential neofunctionalization of reticulon proteins, with members like RTNLB18 potentially evolving specialized roles .

How do mutations in different domains of RTNLB18 affect its function?

Structure-function analysis requires systematic mutational approaches:

  • Domain-specific mutation strategies:

    • Alanine scanning mutagenesis

    • Deletion of specific domains

    • Chimeric proteins with other reticulons

    • Point mutations of conserved residues

  • Functional assays for mutant variants:

    • ER morphology analysis

    • Protein-protein interaction studies

    • Subcellular localization

    • Complementation of knockout phenotypes

  • Interpretation framework:

    • Correlation of mutations with phenotypes

    • Identification of critical residues/regions

    • Mapping to predicted structural features

    • Comparison with related reticulon proteins

In related reticulon proteins, specific domains have been identified as critical for function. For example, in RTNLB1, a Serine-rich region in the N-terminal tail is essential for interaction with immune receptor FLS2 . Similar structure-function relationships likely exist for RTNLB18, with different domains mediating specific activities or interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.