Recombinant Arabidopsis thaliana Reticulon-like protein B1 (RTNLB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana Reticulon-like protein B1 (RTNLB1) is a reticulon-like protein that influences the immune response and other functions in Arabidopsis thaliana . RTNLB1, part of the reticulon protein family, is involved in endoplasmic reticulum (ER) structure modulation and the transport of proteins within the cell .

Interaction with FLS2

RTNLB1 interacts with FLS2 (flagellin sensing 2), a receptor kinase that recognizes bacterial flagellin and initiates plant immune responses . The interaction between RTNLB1 and FLS2 is specific, as RTNLB1 does not interact with other similar receptors such as EFR (EF-Tu receptor) .

  • RTNLB1 and its homolog RTNLB2 modulate FLS2 immune activity by controlling FLS2 anterograde transport .

  • The Ser-rich region LCR2 in the N-terminal tail of RTNLB1 is critical for interaction with FLS2 .

  • RTNLB1 influences FLS2 glycosylation but not FLS2 stability, causing FLS2 retention in the endoplasmic reticulum (ER) .

Experiments with RTNLB1 mutants have shown :

  • LCR2 is necessary, but not solely sufficient, for the interaction of RTNLB1 with FLS2.

  • Deletion of LCR1 reduces RTNLB1 stability.

Role in Plant Immunity

RTNLB1 and RTNLB2 are necessary for PAMP (pathogen-associated molecular pattern)-triggered activation of MAPKs (mitogen-activated protein kinases) and PTI (pattern-triggered immunity) early marker genes .

  • Plants lacking RTNLB1 and RTNLB2 (rtnlb1 rtnlb2) or overexpressing RTNLB1 (RTNLB1ox) show reduced activation of FLS2-dependent signaling and increased susceptibility to pathogens .

  • In both rtnlb1 rtnlb2 and RTNLB1ox mutants, FLS2 accumulation at the plasma membrane is significantly affected compared with the wild type .

  • Excess RTNLB1 suppresses FLS2-triggered signaling, with RTNLB1ox plants displaying severe impairment in the activation of MAPKs and marker expression .

The transcript accumulation of RTNLB1 is induced during PTI in an FLS2-dependent manner, further supporting its role in plant immunity .

Additional Functions and Interactions

Besides its role in plant immunity, RTNLB1 is also involved in other cellular processes :

  • RTNLB1 is associated with the formation of ER tubular structures .

  • Reticulon proteins in plants, including RTNLB1, bind to Atg8 under ER stress to promote reticulophagy, which alleviates ER stress .

  • RTNLB3, another reticulon protein in Arabidopsis, inhibits the fusion activity of RHD3, impacting root hair development .

  • RTNLB16 splice variants affect sensitivity to abscisic acid and tolerance to darkness-induced senescence .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please specify this in your order; we will prioritize fulfilling this request.
Synonyms
RTNLB1; BTI1; At4g23630; F9D16.100; Reticulon-like protein B1; AtRTNLB1; VirB2-interacting protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB1
Target Protein Sequence
MAEEHKHDESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPS SPSSSMKSKVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEY HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFS SLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDP LGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKKKD
Uniprot No.

Target Background

Function
This protein plays a role in Agrobacterium-mediated plant transformation through its interaction with VirB2, a key component of the T-pilus.
Database Links

KEGG: ath:AT4G23630

STRING: 3702.AT4G23630.1

UniGene: At.25485

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in root tissues.

Q&A

What is RTNLB1 and what are its primary functions in Arabidopsis thaliana?

RTNLB1 is a reticulon-like protein that plays crucial roles in endoplasmic reticulum (ER) structure modulation and protein trafficking within the cell. It belongs to the reticulon protein family characterized by membrane-spanning domains that generate and stabilize ER tubule curvature.

RTNLB1 has been shown to:

  • Regulate the transport of newly synthesized FLS2 (flagellin sensing 2) immune receptor to the plasma membrane

  • Modulate plant immune responses

  • Influence ER membrane structure

  • Interact with specific immune receptors through specialized domains

Methodologically, researchers should approach RTNLB1 functional studies using both loss-of-function (rtnlb1 mutants) and gain-of-function (RTNLB1ox) approaches, as both disruptions affect cellular processes but through different mechanisms .

How is RTNLB1 structurally organized and what domains are functionally significant?

RTNLB1 contains several key structural elements that determine its function:

Structural ElementPositionFunctionExperimental Evidence
Low-complexity region 1 (LCR1)N-terminal regionContributes to RTNLB1 stabilityDeletion reduces protein accumulation
Ser-rich region (LCR2)N-terminal regionCritical for FLS2 interactionDeletion significantly reduces FLS2 binding
Tyr-dependent trafficking motif 1 (TDM1)Near LCR2 in N-terminal regionInvolved in protein traffickingMutation affects FLS2 transport
Tyr-dependent trafficking motif 2 (TDM2)C-terminal regionInvolved in protein traffickingMutation affects FLS2 transport
Transmembrane domainsTwo wedge-shaped domainsER membrane insertion and curvatureStructure analysis

To study these domains, researchers should use targeted mutagenesis approaches, creating deletions (e.g., ΔN lacking LCR1 and LCR2, ΔP lacking LCR2) or specific motif mutations (e.g., TV1 and TV2 lacking TDM1 or TDM2 respectively) .

How does RTNLB1 expression change during plant development and stress responses?

RTNLB1 transcript accumulation is induced during pattern-triggered immunity (PTI) in an FLS2-dependent manner. Specifically:

  • Basal expression occurs in multiple tissues but is enriched in tissues with high secretory activity

  • RTNLB1 transcript levels increase approximately threefold at 3 hours after flg22 (bacterial flagellin peptide) elicitation in wild-type plants

  • This induction is absent in fls2 mutants, confirming the FLS2-dependency

  • RTNLB1 expression is likely coordinated with other immune components

For studying RTNLB1 expression, researchers should employ qRT-PCR with appropriate reference genes and consider tissue-specific expression patterns. RNA samples should be collected at multiple timepoints (0, 1, 3, 6, 12, 24 hours) after immune elicitation to capture the dynamic expression profile .

What techniques are most effective for studying RTNLB1 protein interactions?

Multiple complementary approaches should be used to verify RTNLB1 interactions:

  • Protein microarrays: Successfully identified RTNLB1 as an FLS2-interacting protein in initial screens

  • Split luciferase complementation assays:

    • Can detect protein interactions in planta

    • Requires fusion of luciferase fragments to potential interacting partners

    • Provides quantitative interaction data

  • Co-immunoprecipitation (Co-IP):

    • Confirmation of in vivo interactions

    • RTNLB1-HA successfully co-immunoprecipitated with FLS2-GFP or FLS2-FLAG

    • Did not co-immunoprecipitate with EFR-FLAG or GFP-FLAG (negative controls)

    • Demonstrates interaction specificity

  • Domain mapping through mutant variants:

    • Create deletion constructs targeting specific domains

    • Test interaction through Co-IP

    • Example: The ΔP construct lacking LCR2 showed significantly reduced interaction with FLS2

When designing interaction experiments, include appropriate positive controls (such as known interacting partners SYP122 and VAMP727) and negative controls (such as SYP122 and PHT4) .

What phenotypic assays best demonstrate RTNLB1 function in plant immunity?

Several complementary assays effectively demonstrate RTNLB1 function in immunity:

  • MAPK activation assays:

    • Measure phosphorylation of MPK3 and MPK6 after flg22 treatment

    • Both rtnlb1 rtnlb2 double mutants and RTNLB1ox plants show reduced MAPK activation

  • Immune marker gene expression:

    • qRT-PCR analysis of early PTI marker genes after elicitor treatment

    • Genes typically include FRK1, WRKY22, and WRKY29

    • Shows transcriptional consequences of RTNLB1 disruption

  • Bacterial infection assays:

    • Pre-treat plants with flg22 or mock solution

    • Infect with Pseudomonas syringae pv. tomato DC3000

    • Quantify bacterial multiplication after 2-3 days

    • Both rtnlb1 rtnlb2 and RTNLB1ox show increased susceptibility to infection

  • FLS2 localization and glycosylation analysis:

    • Confocal microscopy to visualize FLS2-GFP localization

    • Western blot to assess glycosylation status

    • RTNLB1ox plants show FLS2 retention in ER and altered glycosylation

For proper controls, include wild-type, fls2 mutant, and potentially other trafficking mutants for comparison .

How should researchers approach gene expression studies for RTNLB1 and related genes?

When studying RTNLB1 gene expression:

  • Reference gene selection:

    • Use multiple reference genes for normalization (e.g., ACT2, UBQ10, GAPDH)

    • Verify reference gene stability under experimental conditions

  • qRT-PCR design:

    • Target unique regions that distinguish RTNLB1 from close homologs like RTNLB2

    • Consider primer positions relative to T-DNA insertions in mutant lines

    • Include appropriate no-template and no-RT controls

  • RNA-seq approach:

    • For genome-wide expression effects of RTNLB1 mutation/overexpression

    • Can reveal affected pathways (as seen with related reticulon genes)

    • Helps identify co-expressed gene modules

  • Transcript variant analysis:

    • Consider analyzing all splice variants, as demonstrated with RTNLB16

    • RT-PCR with isoform-specific primers can detect expression of different variants

For experimental design, include appropriate timepoints after treatment (0, 1, 3, 6, 12, 24 hours) and compare expression in different tissues relevant to immunity (leaves, roots) .

How do RTNLB1 and RTNLB2 coordinate to regulate FLS2 trafficking and what are the functional consequences of their disruption?

RTNLB1 and RTNLB2 work together to regulate FLS2 trafficking with distinct but overlapping functions:

  • Both proteins physically interact with FLS2 in vivo

  • Double mutants (rtnlb1 rtnlb2) show stronger phenotypes than single mutants, indicating partial functional redundancy

  • Both proteins affect FLS2 accumulation at the plasma membrane

Functional consequences of disruption include:

  • In rtnlb1 rtnlb2 double mutants:

    • Reduced FLS2 accumulation at the plasma membrane

    • Diminished MAPK activation upon flg22 treatment

    • Impaired transcriptional induction of PTI marker genes

    • Increased susceptibility to bacterial pathogens

  • In RTNLB1 overexpression lines (RTNLB1ox):

    • FLS2 retention in the ER

    • Altered FLS2 glycosylation pattern

    • Severely impaired MAPK activation and marker gene expression

    • Increased pathogen susceptibility

The similar phenotypes from opposite genetic manipulations demonstrate the importance of precisely balanced RTNLB1/2 levels for proper immune receptor trafficking. This resembles findings with other reticulon proteins, where proper isoform balance is critical (as seen with RTNLB16) .

For studying these interactions, combine genetic approaches (single and double mutants, overexpression) with cellular localization studies and immune function assays .

What is the relationship between RTNLB1 and other membrane trafficking pathways in plants?

RTNLB1 functions within a broader network of membrane trafficking components:

  • Interaction with sorting machinery:

    • The presence of Tyr-dependent sorting motifs (TDMs) in RTNLB1 suggests interaction with clathrin adaptor complexes

    • Removal of these motifs partially reverses negative effects on FLS2 transport

  • Coordination with other reticulon proteins:

    • 21 reticulon proteins exist in Arabidopsis (RTNLB1-21)

    • Different reticulons show specialized functions while maintaining some overlap

    • RTNLB3 and RTNLB13, for example, interact with RHD3 to regulate ER structure

  • Integration with ER quality control:

    • RTNLB1 affects glycosylation status of FLS2

    • May work alongside ER chaperones and quality control machinery

  • Relationship to secretory and endocytic trafficking:

    • RTNLB1 primarily affects anterograde transport

    • Unknown how it might influence endocytic recycling of receptors

    • Could interact with SNARE proteins that mediate vesicle fusion

To investigate these relationships experimentally, researchers should:

  • Conduct proteomic analyses of RTNLB1 complexes under different conditions

  • Employ genetic approaches combining mutations in multiple trafficking components

  • Use live-cell imaging with fluorescently-tagged trafficking markers

How does the phosphorylation state of RTNLB1 regulate its function?

Phosphorylation appears to be an important regulatory mechanism for RTNLB1 function:

  • Ser-61 within the LCR2 region of RTNLB1 is phosphorylated following flagellin elicitation

  • This phosphorylation occurs in a region critical for FLS2 interaction

  • The timing suggests a potential feedback mechanism in immune signaling

For investigating phosphorylation:

  • Phospho-site mutant analysis:

    • Generate S61A (non-phosphorylatable) and S61D (phospho-mimetic) variants

    • Test for alterations in:

      • FLS2 binding affinity

      • Subcellular localization of RTNLB1

      • Effects on FLS2 trafficking

  • Kinase identification:

    • Identify kinases responsible for RTNLB1 phosphorylation

    • Test whether immune-activated kinases like BIK1 might phosphorylate RTNLB1

    • Use in vitro kinase assays with purified components

  • Temporal dynamics:

    • Monitor phosphorylation state changes after immune elicitation

    • Correlate with changes in RTNLB1-FLS2 interactions and FLS2 trafficking

While direct evidence for phosphorylation-dependent regulation is limited, the presence of a phosphorylated residue in the critical interaction domain suggests an important regulatory mechanism worthy of further investigation .

How do reticulon proteins like RTNLB1 coordinate with other ER-shaping proteins to regulate ER structure and function?

Reticulon proteins work within a complex network of ER-shaping and fusion proteins:

  • Interaction with ER fusion machinery:

    • In Arabidopsis, ROOT HAIR DEFECTIVE3 (RHD3) mediates ER tubule fusion

    • RTNLB3 physically interacts with RHD3 at specific points on ER tubules and at three-way junctions

    • RTNLB3 inhibits RHD3 fusion activity, partly by interfering with RHD3 dimerization

  • Genetic interactions:

    • The rtnlb3 rhd3-8 double mutant has a less severe phenotype than rhd3-8 alone

    • This indicates antagonistic genetic relationship between reticulons and RHD3

    • Similar antagonistic relationships might exist between RTNLB1 and fusion machinery

  • Functional consequences for cellular processes:

    • Proper balance between reticulons and fusion machinery is essential for:

      • ER network formation and maintenance

      • Protein trafficking

      • Cellular stress responses

      • Plant development

For studying these interactions:

  • Generate double mutants between rtnlb1 and ER fusion mutants

  • Use live-cell imaging to monitor ER structure in various genetic backgrounds

  • Employ BiFC or FRET techniques to visualize protein interactions in specific ER subdomains

This antagonistic relationship is evolutionarily conserved, as similar counterbalancing has been observed between reticulons and atlastins in Drosophila .

How might knowledge about RTNLB1 be applied to enhance plant disease resistance?

Understanding RTNLB1 function offers several potential applications for enhancing plant disease resistance:

  • Optimizing receptor trafficking:

    • Fine-tuning RTNLB1/2 expression levels could optimize immune receptor accumulation

    • Targeted modifications to interaction domains might enhance receptor trafficking without disrupting other functions

    • Expression of engineered reticulon variants under pathogen-responsive promoters

  • Improving broad-spectrum resistance:

    • RTNLB1/2 affect multiple immune receptors (stronger effect on FLS2, moderate effect on EFR)

    • Optimizing their function could enhance recognition of multiple PAMPs

    • This might provide horizontal resistance against diverse pathogens

  • Stress priming strategies:

    • RTNLB1 is induced during immune responses

    • Controlled pre-induction might prime plant defense systems

    • Could enhance responsiveness to subsequent pathogen attacks

For translational applications, researchers should:

  • Test effects in crop species with agricultural importance

  • Evaluate potential developmental or yield trade-offs

  • Consider tissue-specific or conditional expression strategies

What are the most promising directions for future research on RTNLB1 and related reticulon proteins?

Several promising research directions emerge from current knowledge:

  • Comprehensive reticulon family analysis:

    • Systematic functional comparison of all 21 Arabidopsis RTNLBs

    • Identification of specialized vs. redundant functions

    • Evolutionary analysis across plant species

  • Reticulon-driven ER remodeling during stress:

    • Investigate dynamic changes in reticulon localization and function during:

      • Pathogen infection

      • Abiotic stresses (drought, heat, salt)

      • ER stress conditions

    • Connect to broader cellular stress responses

  • Interplay with autophagy pathways:

    • Recent evidence suggests reticulons modulate ER-phagy in maize

    • Investigate if RTNLB1 influences stress-induced autophagy

    • Study how this impacts cellular homeostasis and stress resilience

  • High-resolution structural studies:

    • Determine atomic-level structures of RTNLB1 alone and in complex with FLS2

    • Elucidate membrane integration and curvature induction mechanisms

    • Guide structure-based engineering approaches

  • Systems biology approaches:

    • Network analysis integrating transcriptomics, proteomics, and metabolomics

    • Model impacts of reticulon function on cellular homeostasis

    • Identify key regulatory nodes and feedback mechanisms

These research directions would significantly advance our understanding of how reticulon proteins like RTNLB1 contribute to plant cellular organization, immunity, and stress responses .

What are the best practices for producing and working with recombinant RTNLB1?

When working with recombinant RTNLB1:

  • Expression system selection:

    • E. coli expression is challenging due to membrane protein nature

    • Consider plant-based expression systems for proper folding and modification

    • Yeast and insect cell systems represent intermediate options

  • Construct design considerations:

    • Include appropriate epitope tags (HA, FLAG, GFP) for detection

    • Consider position effects - C-terminal tags may be preferable

    • For structural studies, construct truncated versions lacking membrane domains

  • Purification approaches:

    • Use mild detergents (DDM, LMNG) for membrane extraction

    • Consider nanodiscs or liposomes for maintaining native structure

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

  • Functional assays:

    • In vitro binding assays with purified FLS2

    • Reconstitution in liposomes to study membrane effects

    • Cell-free expression systems for rapid screening

For protein stability and handling:

  • Store at -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Use aliquots at 4°C for up to one week

How can researchers effectively generate and validate RTNLB1 mutants for functional studies?

Effective strategies for generating and validating RTNLB1 mutants include:

  • T-DNA insertion mutant identification:

    • Screen available T-DNA collections (SALK, SAIL, GABI-Kat)

    • Use PCR-based genotyping to confirm homozygosity

    • Verify transcript disruption via RT-PCR and qRT-PCR

  • Site-directed mutagenesis approaches:

    • Target specific functional domains (LCR1, LCR2, TDMs)

    • For phosphorylation studies, create S61A (non-phosphorylatable) and S61D (phospho-mimetic) variants

    • Validate effects on protein interaction using Co-IP

  • CRISPR/Cas9 genome editing:

    • Design sgRNAs targeting specific exons

    • Consider targeting regions unique to RTNLB1 to avoid off-target effects on RTNLB2

    • Validate edits by sequencing and protein expression analysis

  • Validation approaches:

    • Molecular: RT-PCR, qRT-PCR, Western blot

    • Cellular: Localization studies, protein interaction assays

    • Physiological: Immune response assays, pathogen susceptibility tests

    • ER morphology: Confocal microscopy with ER markers

  • Complementation strategy:

    • Reintroduce wild-type or mutant variants under native promoter

    • Use fluorescent protein fusions for localization studies

    • Confirm functionality through phenotypic rescue

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.