Recombinant Arabidopsis thaliana Reticulon-like protein B21 (RTNLB21)

Shipped with Ice Packs
In Stock

Description

Protein Overview

RTNLB21 (UniProt ID: Q56X72) belongs to the reticulon family, which modulates endoplasmic reticulum (ER) morphology and vesicular trafficking. The recombinant form spans residues 1–487 of the native protein and includes key structural domains critical for interaction with immune receptors like FLS2 (Flagellin Sensing 2) .

Functional Insights

RTNLB21 regulates the anterograde transport of immune receptors to the plasma membrane. Key findings include:

  • Interaction with FLS2: RTNLB21 binds FLS2 via its N-terminal Ser-rich region, facilitating FLS2 trafficking to the plasma membrane .

  • Pathogen Susceptibility: Mutants lacking RTNLB1/2 homologs exhibit impaired FLS2 signaling and increased susceptibility to bacterial pathogens .

  • Induction During Immunity: RTNLB21 transcription increases threefold post-flg22 elicitation, dependent on FLS2 activity .

Experimental Uses

  • ELISA/Immunoassays: Detects interactions with immune receptors (e.g., FLS2) .

  • Trafficking Studies: Analyzes ER-to-plasma membrane transport mechanisms .

  • Plant Immunity Models: Tests pathogen response in RTNLB1/2-knockout or overexpression lines .

Research Findings

  • FLS2 Trafficking: RTNLB1/2 overexpression disrupts FLS2 accumulation at the plasma membrane, reducing flg22-induced ROS burst and MAPK activation .

  • Domain Functionality:

    • Deletion of the N-terminal Ser-rich region (ΔP mutant) abolishes FLS2 interaction .

    • Tyr-based motifs (TDMs) mediate ER export and endosomal sorting .

Future Directions

Current gaps include elucidating RTNLB21’s role in non-immune pathways and its interplay with other reticulons (e.g., RTNL3/4). Structural studies using cryo-EM or X-ray crystallography could clarify its membrane-shaping mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
RTNLB21; At5g58000; MTI20.26; Reticulon-like protein B21; AtRTNLB21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB21
Target Protein Sequence
MTPRRSLSSSDSNDKSPSVSVVAKKARSESVEGIEKKTTPGRVKKIRSEVCTTIVKAGEF DSVALRKVNSLPSPNSEKSDTKTEQEVTIIENSKIPEEVKEFGVCQEMIVSAKSNENEQI DNGDQEIGDQDDYEEDGDEEEEREVEKKSVDVKEINVAKENRVGGVEIKKFSQFQNRTSP SPSSVRKISPPVIKRATSVYSAPPNSTSSTDRFAEQEDNFTHSQSKLQSLVDLVMWRDVS RSTLVFGFGTFLIISSSYANDLNFSFISVVAYMGLIYLGLMFVLKSLIHRGMVEEERHKV VGVREEDVKRMLRLIMPYLNESLHQLRALFSGDPSTTLKMGVVLFVLARCGSSITLWNLA KFGFLGAFTIPKIFISYSTHFSAYGNFWMRRFRDAWESCNHKKAVALALFTLVWNLSSVT ARVWAAFMLLVAFRYYQHKMIWTTDQADDDEDDNEEEEAEEEKEQVPPKHKRAPPHMMMP NKLKKIS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G58000

STRING: 3702.AT5G58000.1

UniGene: At.29301

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How do I effectively express and purify recombinant RTNLB21?

The optimal expression system for RTNLB21 is E. coli with an N-terminal His tag. The recombinant protein spans the full length (amino acids 1-487) of the native protein. After expression, the protein is typically prepared as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

For reconstitution and storage:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot for long-term storage at -20°C/-80°C

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

The reconstituted protein is stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability during storage .

What experimental models are suitable for studying RTNLB21 function?

Based on research with related reticulon-like proteins, several experimental approaches are recommended:

  • Genetic knockout/knockdown models: Creating rtnlb21 mutants in Arabidopsis thaliana using T-DNA insertion lines or CRISPR-Cas9 technology can provide insights into the protein's function through phenotypic analysis. Similar approaches with RTNLB1 and RTNLB2 have revealed their roles in immune receptor trafficking .

  • Overexpression models: Generating transgenic plants that overexpress RTNLB21 can reveal gain-of-function phenotypes, as demonstrated with RTNLB1 overexpression studies .

  • Protein-protein interaction assays: Techniques such as yeast two-hybrid, co-immunoprecipitation, and protein microarrays can identify RTNLB21 interaction partners, potentially revealing functional networks. This approach successfully identified RTNLB1's interaction with the immune receptor FLS2 .

  • Subcellular localization studies: Fluorescently tagged RTNLB21 can be used to determine its localization within plant cells, providing clues about its function in specific cellular compartments.

How might RTNLB21 contribute to plant immune responses?

Based on studies of related reticulon-like proteins, RTNLB21 may play a significant role in plant immunity through several potential mechanisms:

  • Receptor trafficking modulation: Related reticulon proteins RTNLB1 and RTNLB2 interact with the immune receptor FLS2 and modulate its transport to the cell membrane, which affects receptor signaling efficacy and cellular immune responses . RTNLB21 might similarly regulate the trafficking of immune receptors.

  • Support for NLR-mediated immunity: Plant nucleotide-binding leucine-rich repeat receptors (NLRs) function as intracellular immune receptors that perceive pathogen-derived virulence proteins. There are two major types: TNLs (Toll/interleukin-1 receptor resistance domain-containing) and CNLs (coiled-coil domain-containing) . RTNLB21 might function within this network.

  • Potential involvement in helper NLR functions: Some NLRs, specifically the RPW8-CC domain containing NLR (RNL) subclass, act as "helper" NLRs during immune responses. The ADR1 and NRG1 gene families contribute to basal resistance, effector-triggered immunity, and defense gene expression regulation . RTNLB21 might interact with these helper NLRs.

The table below summarizes potential immune-related functions of RTNLB21 based on knowledge of related reticulon proteins:

Potential FunctionMechanismSupporting Evidence from Related Proteins
Immune receptor traffickingRegulation of receptor transport to plasma membraneRTNLB1/2 modulate FLS2 transport
Immune signaling modulationAlteration of receptor-dependent signaling pathwaysPlants lacking RTNLB1/2 show reduced FLS2-dependent signaling
Pathogen resistanceSupport of basal defense mechanismsRTNLB1/2 mutants show increased susceptibility to pathogens
NLR signaling networkPotential interaction with helper NLRsRNLs contribute to effector-triggered immunity

What methodologies are most effective for characterizing RTNLB21 phosphorylation states?

Phosphorylation can significantly impact protein function. Based on findings with related reticulon proteins, RTNLB21 likely undergoes phosphorylation, particularly in serine-rich regions. For example, Ser-61 of the LCR2 region in RTNLB1 was found to be phosphorylated following flagellin elicitation .

Recommended methodologies for characterizing RTNLB21 phosphorylation include:

  • Mass spectrometry-based phosphoproteomic analysis:

    • Enrich for phosphopeptides using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC)

    • Perform liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Analyze data with specialized software (e.g., MaxQuant, Proteome Discoverer) to identify phosphorylation sites

  • Site-directed mutagenesis:

    • Generate phospho-null (Ser/Thr/Tyr → Ala) and phospho-mimetic (Ser/Thr → Asp/Glu, Tyr → Glu) mutants

    • Assess functional consequences through in vivo and in vitro assays

    • Compare phenotypes of wild-type and mutant proteins

  • Phosphorylation-specific antibodies:

    • Develop antibodies against predicted phosphorylation sites

    • Use for western blotting and immunolocalization studies

    • Monitor phosphorylation dynamics under different conditions

  • Kinase inhibitor studies:

    • Identify potential kinases using bioinformatic prediction tools

    • Test specific kinase inhibitors to assess their impact on RTNLB21 function

    • Perform in vitro kinase assays to confirm direct phosphorylation

How do the structural domains of RTNLB21 compare to other reticulon-like proteins in Arabidopsis?

Reticulon-like proteins in Arabidopsis contain several conserved structural elements that contribute to their functions. Based on sequence analysis of RTNLB21 and comparison with related proteins like RTNLB1, RTNLB2, RTNLB3, and RTNLB4, the following structural features are notable:

  • N-terminal region: Contains variable sequences that often include low complexity regions (LCRs). In RTNLB1 and RTNLB2, there are two such regions: LCR1 (a 17-residue sequence present in both RTNLB1 and RTNLB2 but not in RTNL3 or RTNL4) and LCR2 (a serine-rich region of 30 residues in RTNLB1, shorter in RTNLB2, and further truncated in RTNL4 and RTNL3) .

  • Tyr-dependent trafficking motifs (TDMs): RTNLB1 contains two putative TDMs - TDM1 located near LCR2 in the N-terminal region and TDM2 in the C-terminal region . These motifs may be involved in protein trafficking.

  • Reticulon homology domain (RHD): A characteristic feature of reticulon proteins, typically containing two hydrophobic regions that are proposed to form hairpin structures in the membrane.

The table below compares putative structural features of RTNLB21 with those identified in related proteins:

Structural FeatureRTNLB1RTNLB2RTNLB21 (Predicted)
Low Complexity Region 1 (LCR1)Present (17 residues)Present (17 residues)Likely present
Serine-rich Region (LCR2)Present (30 residues)Present (26 residues)Present (based on sequence)
Tyr-dependent Trafficking Motif 1 (TDM1)Present (N-terminal)PresentPotentially present
Tyr-dependent Trafficking Motif 2 (TDM2)Present (C-terminal)PresentPotentially present
Reticulon Homology Domain (RHD)PresentPresentPresent
Phosphorylation SitesSer-61 in LCR2MultiplePredicted in Ser-rich regions

What are the critical controls for studying RTNLB21 interactions with immune receptors?

When investigating potential interactions between RTNLB21 and immune receptors, several critical controls should be included:

  • Protein expression level controls:

    • Western blot analysis to confirm expression levels of both RTNLB21 and the potential interacting protein

    • Quantification of relative expression levels in different experimental conditions

    • Use of constitutive promoters to ensure consistent expression

  • Interaction specificity controls:

    • Include structurally related non-interacting proteins (e.g., other reticulon-like proteins)

    • Test truncated versions of RTNLB21 lacking specific domains

    • Use point mutations in predicted interaction interfaces

  • Subcellular localization controls:

    • Co-localization studies with established organelle markers

    • Fractionation experiments to confirm compartment-specific interactions

    • Assessment of interaction in different cellular compartments

  • Functional validation controls:

    • Genetic complementation tests with RTNLB21 mutants

    • Phenotypic assays to assess functional consequences of disrupted interactions

    • Dose-response experiments to establish concentration-dependent effects

How can RNA sequencing data be used to understand RTNLB21 function in different developmental contexts?

RNA sequencing (RNA-seq) is a powerful tool for understanding gene function in different developmental contexts. For RTNLB21, RNA-seq can provide insights into:

  • Expression patterns across tissues and developmental stages:

    • Compare RTNLB21 expression in different tissues (roots, leaves, flowers, etc.)

    • Analyze expression changes during developmental processes

    • Identify co-expressed genes that may function in the same pathways

  • Transcriptional responses to RTNLB21 manipulation:

    • Compare transcriptomes of wild-type and rtnlb21 mutant plants

    • Analyze differentially expressed genes in RTNLB21 overexpression lines

    • Identify regulatory networks affected by RTNLB21 manipulation

  • Response to biotic and abiotic stresses:

    • Analyze how RTNLB21 expression changes under different stress conditions

    • Compare stress responses in wild-type and rtnlb21 mutant plants

    • Identify stress-specific co-expression networks

Recommended RNA-seq experimental design:

Experimental GroupDescriptionReplicatesAnalysis Focus
Wild-type (Col-0)Control plants3-4 biologicalBaseline expression
rtnlb21 knockoutPlants lacking RTNLB213-4 biologicalLoss-of-function effects
RTNLB21 overexpressionPlants overexpressing RTNLB213-4 biologicalGain-of-function effects
Tissue seriesVarious tissues from wild-type plants3 biological per tissueTissue-specific expression
Developmental seriesVarious developmental stages3 biological per stageDevelopmental regulation
Stress treatmentsPlants exposed to pathogens, abiotic stresses3-4 biological per conditionStress-responsive functions

The RNA-seq data should be processed using a standardized bioinformatics pipeline, including quality control, read alignment, quantification of gene expression, differential expression analysis, and functional enrichment analysis to identify pathways and processes affected by RTNLB21 .

How do you reconcile conflicting phenotypic data from different RTNLB21 mutant lines?

Researchers often encounter conflicting phenotypic data when studying different mutant lines for the same gene. To reconcile such contradictions with RTNLB21 mutants:

  • Analyze mutation characteristics:

    • Determine the precise location and nature of each mutation (T-DNA insertion, point mutation, deletion)

    • Assess whether mutations result in complete knockout or partial loss of function

    • Verify absence of protein using western blot with specific antibodies

  • Evaluate genetic background effects:

    • Compare the genetic backgrounds of different mutant lines

    • Create isogenic lines through backcrossing to eliminate background effects

    • Perform complementation tests between different mutant alleles

  • Consider functional redundancy:

    • Investigate potential redundancy with other reticulon-like proteins

    • Create and analyze double or higher-order mutants with related genes

    • Similar to how ADR1 and NRG1 families act in an unequally redundant manner in immune responses

  • Assess environmental influences:

    • Standardize growth conditions across experiments

    • Test phenotypes under various environmental conditions

    • Document all experimental parameters meticulously

  • Use CRISPR-Cas9 to generate new mutants:

    • Create clean, well-defined mutations with minimal off-target effects

    • Generate multiple independent mutant lines

    • Compare phenotypes across independent lines to establish consistency

What computational approaches are most effective for predicting RTNLB21 membrane topology and protein-protein interaction sites?

Predicting membrane topology and protein-protein interaction sites for reticulon-like proteins like RTNLB21 requires specialized computational approaches:

  • Membrane topology prediction:

    • Hydropathy analysis using algorithms like TMHMM, Phobius, or TOPCONS

    • Coarse-grained molecular dynamics simulations to model membrane insertion

    • Integration of evolutionary conservation data to refine predictions

    • Prediction of reticulon-specific hairpin structures in the membrane

  • Protein-protein interaction site prediction:

    • Identification of conserved motifs using MEME, GLAM2, or similar tools

    • Interface prediction using SPPIDER, WHISCY, or PredUs

    • Molecular docking simulations with known or predicted interaction partners

    • Analysis of co-evolving residue pairs as potential interaction sites

  • Structural modeling approaches:

    • Template-based modeling using related proteins with known structures

    • Ab initio modeling for domains lacking structural homologs

    • Refinement using molecular dynamics simulations

    • Integration of experimental constraints from cross-linking or mutagenesis studies

  • Machine learning-based prediction:

    • Neural network approaches trained on known protein-protein interactions

    • Feature extraction from sequence, structure, and evolutionary information

    • Ensemble methods combining multiple predictors for improved accuracy

    • Validation using experimental data from related reticulon proteins

How can CRISPR-Cas9 technology be optimized for studying RTNLB21 function?

CRISPR-Cas9 technology offers powerful approaches for studying RTNLB21 function through precise genome editing:

  • Guide RNA design strategies:

    • Target conserved functional domains for complete loss-of-function

    • Design multiple gRNAs targeting different regions to increase efficiency

    • Use algorithms like CRISPOR or CHOPCHOP to minimize off-target effects

    • Consider chromatin accessibility at the target site to improve efficiency

  • Domain-specific functional analysis:

    • Create truncation mutants by introducing premature stop codons

    • Generate domain-specific deletions to assess the function of individual domains

    • Introduce point mutations in predicted functional residues (e.g., phosphorylation sites)

    • Design in-frame deletions of specific motifs identified in related reticulon proteins

  • Protein tagging strategies:

    • Insert epitope tags or fluorescent proteins for tracking RTNLB21 localization

    • Generate knock-in reporter lines to monitor endogenous expression patterns

    • Create conditional alleles using inducible degradation domains

    • Introduce proximity labeling tags to identify interaction partners in vivo

  • Validation and phenotypic analysis:

    • Confirm editing efficiency using sequencing and western blot analysis

    • Assess phenotypes across multiple independent lines

    • Compare with traditional T-DNA insertion or RNAi lines

    • Perform complementation tests with wild-type or mutated RTNLB21

What are the most promising approaches for elucidating the role of RTNLB21 in modulating immune receptor trafficking?

Based on findings with related reticulon proteins like RTNLB1 and RTNLB2, which modulate the trafficking of the immune receptor FLS2 , several promising approaches can be used to investigate RTNLB21's potential role in immune receptor trafficking:

  • Live-cell imaging techniques:

    • Fluorescently tag RTNLB21 and candidate immune receptors

    • Perform time-lapse confocal microscopy to track co-trafficking

    • Use photoactivatable or photoconvertible fluorescent proteins to track protein movement

    • Implement super-resolution microscopy for detailed subcellular localization

  • Biochemical trafficking assays:

    • Perform subcellular fractionation to quantify receptor distribution

    • Use surface biotinylation assays to measure plasma membrane localization

    • Conduct endocytosis and recycling assays to assess receptor dynamics

    • Implement pulse-chase experiments to track receptor movement through secretory pathways

  • Protein-protein interaction mapping:

    • Perform co-immunoprecipitation with RTNLB21 and candidate immune receptors

    • Use proximity labeling techniques (BioID, APEX) to identify nearby proteins in vivo

    • Implement split-GFP complementation to visualize interactions in specific compartments

    • Conduct yeast two-hybrid or membrane two-hybrid screens for systematic interaction mapping

  • Functional immune assays:

    • Measure immune responses in rtnlb21 mutants after pathogen challenge

    • Compare receptor-mediated signaling in wild-type and mutant plants

    • Assess changes in receptor phosphorylation status

    • Evaluate pathogen susceptibility phenotypes

How might RTNLB21 function in non-immune cellular processes?

While reticulon-like proteins have been studied in the context of immune responses, they likely play roles in other cellular processes as well:

  • Endoplasmic reticulum morphology regulation:

    • Investigate RTNLB21's role in ER tubule formation and maintenance

    • Assess changes in ER morphology in rtnlb21 mutants using ER-targeted fluorescent markers

    • Compare with phenotypes of other reticulon mutants

    • Analyze potential redundancy with other ER-shaping proteins

  • Vesicle trafficking beyond immune receptors:

    • Examine trafficking of developmental receptors (e.g., hormone receptors)

    • Investigate potential roles in protein secretion pathways

    • Assess involvement in vacuolar trafficking

    • Study effects on polarized growth processes

  • Small RNA pathways:

    • Explore potential interactions with components of small RNA pathways

    • Investigate whether RTNLB21 affects siRNA biogenesis similar to RTL1

    • Examine potential roles in epigenetic regulation

    • Assess impacts on transcriptional and post-transcriptional gene silencing

  • Stress responses:

    • Investigate RTNLB21 expression changes under various abiotic stresses

    • Examine potential roles in unfolded protein response

    • Assess functions in membrane remodeling during stress adaptation

    • Study potential interactions with stress signaling components

What evolutionary insights can be gained from comparative analysis of RTNLB21 across plant species?

Evolutionary analysis of RTNLB21 can provide valuable insights into its function and importance:

  • Phylogenetic analysis approaches:

    • Identify RTNLB21 orthologs across diverse plant species

    • Construct phylogenetic trees to understand evolutionary relationships

    • Compare evolutionary rates across different plant lineages

    • Identify conserved and divergent domains through sequence alignment

  • Selection pressure analysis:

    • Calculate dN/dS ratios to detect signatures of selection

    • Identify sites under positive or purifying selection

    • Compare selection patterns across different domains

    • Correlate selection patterns with known or predicted functional regions

  • Structural conservation analysis:

    • Predict protein structures of RTNLB21 orthologs

    • Compare structural conservation across species

    • Identify structurally conserved regions as potentially functional

    • Model the evolution of protein-protein interaction interfaces

  • Expression pattern conservation:

    • Compare expression patterns of RTNLB21 orthologs across species

    • Identify conserved cis-regulatory elements

    • Assess conservation of stress-responsive expression

    • Evaluate conservation of tissue-specific expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.