Recombinant Arabidopsis thaliana Reticulon-like protein B22 (RTNLB22)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana Reticulon-like protein B22 (RTNLB22) is a protein that belongs to the reticulon family and is found in the plant Arabidopsis thaliana . Reticulon proteins are integral membrane proteins primarily located in the endoplasmic reticulum (ER) and are characterized by a reticulon homology domain (RHD) . RTNLB22, like other reticulons, is involved in various cellular processes, particularly those related to ER function and protein trafficking .

Synonyms: RTNLB22, At1g78895, F9K20.31, Reticulon-like protein B22, AtRTNLB22
UniProt ID: Q8GWH5
Gene Name: RTNLB22

Structure and Properties

RTNLB22 is a full-length protein consisting of 164 amino acids . Recombinant RTNLB22 is produced in E. coli and fused to an N-terminal His tag to facilitate purification . The protein's amino acid sequence is as follows :

MGEMGKAMGLLISGTLVYYHCAYRNATLLSLFSDVFIVLLCSLAILGLLFRQLNVSVPVD
PLEWQISQDTASNIVARLANTVGAAEGVLRVAATGHDKRLFVKVVICLYFLSALGRLISG
VTVAYAGLCLFCLSMLCQTSQSLGNCVLKRGNGQILEQEAHSDT

The recombinant protein is typically supplied as a lyophilized powder from a Tris/PBS-based buffer with 6% Trehalose, at a pH of 8.0 . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add 5-50% glycerol for long-term storage at -20°C/-80°C . Repeated freezing and thawing are not recommended . Purity is generally greater than 90% as determined by SDS-PAGE .

Function and Significance

RTNLB22, along with its homolog RTNLB1, plays a role in plant immunity by modulating the transport of receptors like FLS2 (Flagellin-Sensitive 2) to the plasma membrane . FLS2 is a receptor that recognizes bacterial flagellin, initiating plant defense responses .

  • Regulation of FLS2 Trafficking: RTNLB1 and RTNLB2 interact with FLS2 and affect its accumulation at the plasma membrane . Manipulation of RTNLB1 and RTNLB2 expression levels alters the intracellular trafficking of FLS2, influencing FLS2-induced signaling and immunity .

  • Impact on Plant Immunity: Plants lacking both RTNLB1 and RTNLB2 (rtnlb1 rtnlb2) or overexpressing RTNLB1 (RTNLB1ox) show reduced activation of FLS2-dependent signaling and increased susceptibility to pathogens . This indicates that RTNLB1 and RTNLB2 are crucial for the proper functioning of the plant immune system .

  • Interaction with Other Proteins: RTNLB1 interacts with FLS2, and a Ser-rich region in the N-terminal tail of RTNLB1 is critical for this interaction . The N-terminal structural element and two intracellular sorting signals in RTNLB1 are also vital for its functions .

Experimental Evidence

Research has demonstrated the functional significance of RTNLB1 and RTNLB2 in Arabidopsis thaliana :

  • Gene Expression Analysis: Transcript levels of RTNLB1 are induced during Pathogen-Triggered Immunity (PTI) in an FLS2-dependent manner, further supporting its role in plant defense .

  • Mutant Studies: Homozygous T-DNA insertion mutants rtnlb1 and rtnlb2, when treated with flagellin 22 peptide (flg22), exhibit reduced activity of MPK3 and MPK6 (Mitogen-Activated Protein Kinases) and impaired transcriptional induction of early PTI markers .

  • FLS2-dependent Signaling: The rtnlb1 rtnlb2 lines also show impaired EFR-dependent signaling when treated with elf18, suggesting a broader role in receptor-mediated signaling .

Data Representation

CategoryDescription
Protein OverviewRecombinant Full Length Arabidopsis thaliana Reticulon-like protein B22(RTNLB22) Protein (Q8GWH5) (1-164aa), fused to N-terminal His tag, was expressed in E. coli .
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
Protein LengthFull Length (1-164)
FormLyophilized powder
AA SequenceMGEMGKAMGLLISGTLVYYHCAYRNATLLSLFSDVFIVLLCSLAILGLLFRQLNVSVPVD PLEWQISQDTASNIVARLANTVGAAEGVLRVAATGHDKRLFVKVVICLYFLSALGRLISG VTVAYAGLCLFCLSMLCQTSQSLGNCVLKRGNGQILEQEAHSDT
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Gene NameRTNLB22
SynonymsRTNLB22; At1g78895; F9K20.31; Reticulon-like protein B22; AtRTNLB22
UniProt IDQ8GWH5
Expression Region1-164
FeatureImpact
Lack of RTNLB1 and RTNLB2Reduced activation of FLS2-dependent signaling and increased susceptibility to pathogens .
Overexpression of RTNLB1Reduced activation of FLS2-dependent signaling and increased susceptibility to pathogens. FLS2 retention in the endoplasmic reticulum (ER) and affected FLS2 glycosylation but not FLS2 stability .
flg22 treatment of mutantsReduced activity of MPK3 and MPK6, and impaired transcriptional induction of early PTI markers .
elf18 treatment of mutantsImpaired EFR-dependent signaling, indicating defective EFR signaling .
Induction of RTNLB1Induced during PTI in an FLS2-dependent manner, further supporting its role in plant defense .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RTNLB22; At1g78895; F9K20.31; Reticulon-like protein B22; AtRTNLB22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB22
Target Protein Sequence
MGEMGKAMGLLISGTLVYYHCAYRNATLLSLFSDVFIVLLCSLAILGLLFRQLNVSVPVD PLEWQISQDTASNIVARLANTVGAAEGVLRVAATGHDKRLFVKVVICLYFLSALGRLISG VTVAYAGLCLFCLSMLCQTSQSLGNCVLKRGNGQILEQEAHSDT
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G78895

STRING: 3702.AT1G78895.1

UniGene: At.34221

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is RTNLB22 and what is its significance in plant biology?

RTNLB22 (Reticulon-like protein B22) is a member of the plant-specific RTNLB family of reticulon proteins in Arabidopsis thaliana. Reticulons are integral membrane proteins characterized by a conserved reticulon homology domain (RHD) that contains two major hydrophobic regions. Each region typically forms two transmembrane domains connected by a hydrophilic loop.

The RTNLB subfamily in plants is part of a larger evolutionary classification where reticulon-like genes are designated based on taxonomic groups: RTNL for non-chordate metazoans, RTNLA for fungi, RTNLB for plants, and RTNLC for protists . In Arabidopsis thaliana, there are multiple RTNLB proteins (numbered RTNLB1 to RTNLB23 and beyond), with RTNLB22 being one of the less extensively characterized members.

Based on studies of other RTNLB proteins, these proteins are believed to play crucial roles in:

  • Endoplasmic reticulum (ER) membrane shaping and tubulation

  • Protein trafficking between cellular compartments

  • Plant immune responses to pathogens

  • Development and stress responses

What is the basic structure of RTNLB22 and how is it typically recombinantly produced?

RTNLB22 is a relatively small protein of 164 amino acids . Like other reticulon proteins, it likely contains the characteristic reticulon homology domain (RHD) with transmembrane segments that allow it to integrate into membranes, particularly the ER membrane.

For recombinant production, RTNLB22 can be expressed in different systems:

Expression SystemTagProtein LengthPurityProduct Examples
E. coliHis-tagFull length (1-164)>85% (SDS-PAGE)CSB-EP812745DOA1-B
YeastVariablePartial>85% (SDS-PAGE)CSB-YP812745DOA1

Methodology for recombinant production typically involves:

  • Cloning the RTNLB22 coding sequence into an appropriate expression vector

  • Transforming the construct into the expression host (E. coli or yeast)

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Affinity purification using the engineered tag (e.g., His-tag)

  • Quality control via SDS-PAGE and other protein characterization methods

For storage and handling, recommendations include:

  • Storage at -20°C/-80°C (shelf life: 6 months for liquid form, 12 months for lyophilized form)

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage

  • Avoiding repeated freeze-thaw cycles

How does RTNLB22 relate evolutionarily to other reticulon proteins in plants and across species?

Reticulon proteins show a fascinating evolutionary history across different kingdoms. In plants, the RTNLB family has undergone significant expansion compared to other organisms.

Phylogenetic analysis of reticulon proteins reveals:

  • The reticulon homology domain (RHD) is highly conserved across species, suggesting essential functional roles

  • Plant RTNLB proteins form a distinct clade separate from animal and fungal reticulons

  • Within plants, there has been significant diversification of RTNLB proteins, suggesting functional specialization

Analysis based on available sequences indicates that RTNLB22 is part of the plant-specific expansion of reticulon proteins and appears in the Arabidopsis thaliana genome alongside numerous other RTNLB proteins (RTNLB1-RTNLB23 and beyond).

Methodological approach for evolutionary analysis:

  • Sequence alignment of reticulon proteins from diverse species

  • Construction of phylogenetic trees using methods such as maximum likelihood

  • Analysis of gene structure and intron-exon boundaries

  • Examination of syntenic relationships across genomes

The nomenclature system established for reticulon proteins classifies them according to their taxonomic group, with RTNLB specifically designated for plant reticulons .

How can polymorphic regions in RTNLB22 be detected and what might they indicate about evolutionary selection?

Detecting polymorphic regions (PRs) in RTNLB22 requires sophisticated genomic approaches. One effective methodology is the margin-based prediction of polymorphic regions (mPPR) that can be applied to resequencing array data.

The methodology involves:

  • Obtaining resequencing array data for multiple accessions of Arabidopsis thaliana

  • Applying machine learning algorithms (such as mPPR) to identify regions of high polymorphism

  • Comparing PR content across different gene families and functional categories

  • Correlating PR patterns with functional constraints and selective pressures

When applied to the Arabidopsis genome, this approach has revealed interesting patterns about gene family evolution:

Gene FamilyPolymorphism LevelInterpretation
Transcription factorsLow PR contentStrong purifying selection
F-box genesHigher PR contentHigher death rates, more relaxed selection
NB-LRR genesExtreme levels of polymorphismPossible balancing selection
miRNAsLow in conserved regionsFunctional constraints on critical regions

While specific data on RTNLB22 polymorphism is not directly available in the search results, analysis of PR patterns in the reticulon family could provide insights into the evolutionary forces acting on RTNLB22 .

To specifically analyze RTNLB22 polymorphism:

  • Sequence RTNLB22 from multiple Arabidopsis accessions

  • Identify single nucleotide polymorphisms (SNPs) and structural variants

  • Calculate nucleotide diversity (π) and other population genetic parameters

  • Apply tests of selection (e.g., Tajima's D, dN/dS ratio) to determine the nature of selection

What approaches can be used to investigate RTNLB22's subcellular localization and membrane topology?

Understanding the subcellular localization and membrane topology of RTNLB22 is crucial for elucidating its function. Based on studies of other reticulon proteins, several complementary approaches can be employed:

  • Fluorescent Protein Fusion and Microscopy:

    • Generate N- and C-terminal GFP/YFP fusions of RTNLB22

    • Express in Arabidopsis protoplasts or stable transgenic plants

    • Perform co-localization with known organelle markers (ER, Golgi, plasma membrane)

    • Conduct live-cell imaging to observe dynamic localization patterns

  • Membrane Topology Analysis:

    • Protease protection assays to determine cytosolic vs. luminal exposure of protein domains

    • Glycosylation site mapping with artificial glycosylation sites

    • Selective permeabilization with detergents followed by immunofluorescence

    • Biotinylation of surface-exposed lysine residues

  • Biochemical Fractionation:

    • Separate cellular components through differential centrifugation

    • Perform membrane extraction with different detergents or chemicals

    • Use density gradient centrifugation to separate different membrane types

    • Western blot analysis of fractions with anti-RTNLB22 antibodies

  • Electron Microscopy:

    • Immunogold labeling of RTNLB22 in plant tissue sections

    • High-resolution imaging of membrane structures

    • Correlative light and electron microscopy (CLEM) to combine fluorescence and ultrastructural data

Based on reticulon protein structure, RTNLB22 likely contains:

  • Multiple transmembrane domains forming hairpin-like structures in the ER membrane

  • A conserved reticulon homology domain (RHD)

  • Short N- and C-terminal regions that may face the cytosol

How can protein-protein interaction studies be designed to identify RTNLB22 binding partners?

Identifying protein-protein interactions for membrane proteins like RTNLB22 requires specialized approaches. Based on successful studies with related reticulons, the following methodologies are recommended:

  • Protein Microarray Screening:

    • Use purified, tagged RTNLB22 to probe Arabidopsis protein microarrays

    • This approach successfully identified RTNLB1 as an FLS2-interacting protein

    • Validate hits with secondary interaction assays

  • Co-Immunoprecipitation (Co-IP):

    • Express epitope-tagged RTNLB22 in planta

    • Solubilize membranes with appropriate detergents (e.g., digitonin, DDM)

    • Perform IP with anti-tag antibodies followed by mass spectrometry

    • Validate with reverse Co-IP and western blotting

  • Membrane-Based Yeast Two-Hybrid:

    • Use split-ubiquitin or MYTH (membrane yeast two-hybrid) systems

    • Screen against cDNA libraries or candidate interactors

    • Perform quantitative assays for interaction strength

  • Proximity-Based Labeling:

    • Fuse RTNLB22 with BioID, TurboID, or APEX2 enzymes

    • Express in plants and provide labeling substrate

    • Identify biotinylated proximal proteins by streptavidin pulldown and mass spectrometry

  • FRET/FLIM Analysis:

    • Generate fluorophore-tagged versions of RTNLB22 and candidate partners

    • Measure FRET efficiency using acceptor photobleaching or fluorescence lifetime imaging

    • Quantify interaction strength and dynamics in living cells

For data analysis, consider:

  • Filtering out common contaminants and false positives

  • Validating hits with multiple orthogonal techniques

  • Creating interaction networks to identify functional clusters

  • Comparing results with known interactomes of related reticulons

What experimental strategies can determine if RTNLB22 affects membrane curvature or protein trafficking?

Reticulon proteins are known to shape membranes and influence protein trafficking. To investigate these potential functions of RTNLB22, several sophisticated approaches can be employed:

  • ER Morphology Analysis:

    • Express fluorescently tagged ER markers in RTNLB22 knockout and overexpression lines

    • Quantify ER tubule/sheet ratios using confocal microscopy

    • Measure ER network complexity using automated image analysis

    • Apply 3D electron microscopy techniques (electron tomography) for high-resolution analysis

  • Membrane Curvature Assays:

    • Reconstitute purified RTNLB22 into liposomes

    • Measure membrane tubulation using electron microscopy

    • Assess the effect of RTNLB22 concentration on membrane deformation

    • Investigate oligomerization states using cross-linking or native PAGE

  • Protein Trafficking Analysis:

    • Track movement of fluorescently tagged cargo proteins (e.g., secreted GFP, transmembrane proteins)

    • Measure kinetics of protein export from the ER to Golgi and plasma membrane

    • Perform pulse-chase experiments with photoconvertible fluorescent proteins

    • Analyze trafficking in response to various stimuli in wild-type vs. RTNLB22 mutant plants

  • Immune Receptor Trafficking:
    Based on findings with RTNLB1/2 :

    • Monitor accumulation of immune receptors (FLS2, EFR) at the plasma membrane

    • Assess forward signaling efficacy using phosphorylation assays or reporter gene expression

    • Measure endocytosis rates following ligand stimulation

    • Evaluate the impact on pathogen resistance

  • High-Resolution Imaging:

    • Super-resolution microscopy (STED, PALM, STORM) to visualize membrane domains

    • Fast time-lapse imaging to capture dynamic trafficking events

    • Correlative light and electron microscopy for structural context

Research with RTNLB1 and RTNLB2 demonstrated that both loss- and gain-of-function mutations affected FLS2 accumulation at the plasma membrane, suggesting a role in receptor anterograde transport . Similar experimental designs could be applied to investigate RTNLB22's potential impact on trafficking.

How can transcriptomic and proteomic approaches be integrated to understand RTNLB22 function in different contexts?

Integrating multiple -omics approaches provides a comprehensive view of RTNLB22 function across different conditions and developmental stages:

  • Transcriptomic Analysis:

    • RNA-seq to identify co-expressed genes in different tissues/conditions

    • Compare expression patterns between wild-type and RTNLB22 mutants

    • Identify transcriptional responses to relevant stresses or stimuli

    • Search for RTNLB22 in existing transcriptomic datasets (developmental series, stress responses)

  • Proteomic Approaches:

    • Quantitative proteomics of membrane fractions in wild-type vs. mutant plants

    • Phosphoproteomics to identify signaling changes

    • Interact with data from protein-protein interaction studies

    • Analyze post-translational modifications on RTNLB22 itself

  • Integration Strategies:

    • Construct correlation networks from multi-omics data

    • Perform gene ontology and pathway enrichment analyses

    • Use machine learning approaches to identify patterns in complex datasets

    • Apply causal reasoning algorithms to infer regulatory relationships

  • Contextual Analysis:

    • Compare RTNLB22 function across different tissues and developmental stages

    • Analyze responses to biotic and abiotic stresses

    • Investigate potential roles in specific physiological processes

Interestingly, reticulon-like protein B22 (RTNLB22) has been identified in a trans-regulatory relationship with lncRNAs, suggesting potential complex regulatory mechanisms . This finding opens avenues for investigating the regulation of RTNLB22 at transcriptional and post-transcriptional levels.

What are the most efficient experimental designs for functional validation of RTNLB22 in plant development and stress responses?

Efficient functional validation requires well-designed experiments that address multiple aspects of RTNLB22 biology:

  • Genetic Resources Development:

    • Generate multiple independent T-DNA insertion or CRISPR-Cas9 knockout lines

    • Create complementation lines with native promoter-driven RTNLB22

    • Develop tissue-specific or inducible expression systems

    • Establish lines with fluorescently tagged RTNLB22 for localization studies

  • Phenotypic Characterization Matrix:

Developmental StageParameters to MeasureTechniques
Seed germinationGermination rate, seedling establishmentStandard plate assays
Vegetative growthRosette size, leaf morphology, root architectureAutomated phenotyping platforms
Reproductive developmentFlowering time, silique development, seed yieldManual measurements, microscopy
SenescenceChlorophyll degradation, nutrient remobilizationSpectrophotometry, nutrient analysis
  • Stress Response Analysis:

    • Test multiple stresses (drought, salt, heat, cold, pathogens)

    • Measure physiological parameters (ROS, hormones, metabolites)

    • Assess stress-responsive gene expression (qRT-PCR, RNA-seq)

    • Evaluate recovery and survival rates

  • Pathway Integration:

    • Perform epistasis analysis with mutants in related pathways

    • Create and analyze double mutants with other RTNLBs

    • Conduct transcriptome analysis under specific conditions

    • Test sensitivity to pathway inhibitors or activators

  • Organ/Tissue-Specific Functions:

    • Use tissue-specific promoters for complementation

    • Perform laser microdissection followed by RNA/protein analysis

    • Conduct cell-type specific phenotyping using appropriate markers

    • Analyze grafted plants to distinguish shoot vs. root functions

Based on the trans-regulatory relationship identified between RTNLB22 and lncRNAs , designs should also consider:

  • Analysis of lncRNA expression in RTNLB22 mutants

  • Investigation of RTNLB22 expression in lncRNA mutants

  • Identification of shared regulatory elements

  • Characterization of RNA-protein interactions if applicable

By systematically applying these approaches, researchers can efficiently validate and characterize the functions of RTNLB22 in plant development and stress responses.

How do the functions of RTNLB22 compare with well-characterized RTNLB proteins like RTNLB1, RTNLB2, and RTNLB4?

While specific functions of RTNLB22 are not extensively characterized in the available literature, comparative analysis with better-studied RTNLB proteins provides valuable insights:

RTNLB ProteinKnown FunctionsExperimental EvidencePotential RTNLB22 Parallels
RTNLB1/RTNLB2- Interact with FLS2 immune receptor
- Modulate receptor transport to plasma membrane
- Affect immune signaling and pathogen resistance
- Protein microarray identification
- In vivo interaction studies
- Pathogen susceptibility assays
- Receptor localization analysis
May interact with similar or different receptor classes
RTNLB4- Participates in defense responses to A. tumefaciens
- Affects elf18 and VirB2 peptide-induced responses
- Influences H₂O₂ accumulation
- T-DNA insertion mutants
- Gene expression analysis
- Pathogen infection assays
- Seedling growth inhibition tests
May play complementary or redundant roles in pathogen responses

Methodology for comparative analysis:

  • Generate lines with mutations in multiple RTNLB genes to assess functional redundancy

  • Perform complementation studies with chimeric proteins to identify functionally important domains

  • Compare subcellular localization patterns and dynamics

  • Analyze expression patterns across tissues and conditions

  • Assess responses to the same stimuli in different RTNLB mutants

The diversification of the RTNLB family in Arabidopsis (with more than 20 members) suggests functional specialization, potentially with RTNLB22 playing unique roles distinct from other characterized members.

What technical challenges must be overcome when working with membrane proteins like RTNLB22 and how can they be addressed?

Membrane proteins present unique technical challenges for researchers. For RTNLB22 and other reticulon proteins, these challenges and their solutions include:

  • Protein Expression and Purification:

    • Challenge: Membrane proteins often express poorly and may aggregate

    • Solutions:

      • Use specialized expression systems (yeast, insect cells) as alternatives to E. coli

      • Optimize detergent conditions for solubilization

      • Consider fusion partners to enhance solubility

      • Express functional domains separately if full-length protein is problematic

  • Structural Characterization:

    • Challenge: Traditional structural biology methods are difficult with membrane proteins

    • Solutions:

      • Use cryo-electron microscopy for structure determination

      • Apply NMR approaches optimized for membrane proteins

      • Utilize computational modeling based on related protein structures

      • Employ cross-linking mass spectrometry for topology information

  • Functional Assays:

    • Challenge: Assessing function in artificial systems may not reflect in vivo activity

    • Solutions:

      • Develop liposome-based reconstitution systems

      • Create proteoliposomes with defined lipid composition

      • Utilize cell-free expression systems with artificial membranes

      • Design in vivo assays that can detect subtle phenotypes

  • Protein-Protein Interactions:

    • Challenge: Traditional interaction assays may disrupt membrane integrity

    • Solutions:

      • Use membrane-specific two-hybrid systems

      • Apply proximity labeling approaches (BioID, APEX)

      • Optimize detergent conditions for co-immunoprecipitation

      • Perform FRET/FLIM analysis in intact cells

  • Protein Stability and Storage:

    • Challenge: Membrane proteins may lose activity during storage

    • Solutions:

      • Add glycerol (5-50%) for long-term storage

      • Avoid repeated freeze-thaw cycles

      • Store at -20°C/-80°C in appropriate buffer conditions

      • Consider lyophilization for extended stability

These methodological solutions enable researchers to overcome the inherent challenges of working with membrane proteins like RTNLB22, facilitating more robust and reproducible research outcomes.

What emerging technologies could advance our understanding of RTNLB22 function in the next decade?

Several cutting-edge technologies show promise for advancing RTNLB22 research:

  • CRISPR-Based Technologies:

    • Base editing for precise amino acid substitutions without double-strand breaks

    • Prime editing for targeted insertions and complex edits

    • CRISPR interference/activation for temporal control of gene expression

    • CRISPR screens with single-cell readouts for high-throughput phenotyping

  • Advanced Imaging Approaches:

    • Super-resolution microscopy beyond the diffraction limit

    • Live-cell single-molecule tracking to observe individual RTNLB22 proteins

    • Correlative light and electron microscopy for structural context

    • Label-free imaging techniques for non-invasive observation

  • Proteomics Innovations:

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • Cross-linking mass spectrometry for structural information

    • Single-cell proteomics to capture cell-specific variation

    • Top-down proteomics for intact protein analysis with PTMs

  • Synthetic Biology Approaches:

    • Designer membrane proteins with engineered functions

    • Optogenetic control of RTNLB22 activity or localization

    • Biosensors based on RTNLB22 conformational changes

    • Minimal synthetic systems to reconstitute RTNLB22 function

  • Computational Methods:

    • AI-driven protein structure prediction (AlphaFold2/RoseTTAFold)

    • Molecular dynamics simulations of membrane-protein interactions

    • Network modeling of protein interactions and effects

    • Integrative multi-omics data analysis

These emerging technologies promise to provide unprecedented insights into the molecular mechanisms, dynamic behavior, and functional roles of RTNLB22 in plant biology.

What are the most promising directions for translational research involving RTNLB22 and other reticulon proteins?

Understanding RTNLB22 and related reticulon proteins opens several promising avenues for translational research:

  • Agricultural Applications:

    • Engineering enhanced disease resistance by modulating reticulon-mediated immune receptor trafficking

    • Improving stress tolerance through optimization of ER structure and function

    • Enhancing crop yield by fine-tuning development-related protein trafficking

    • Creating diagnostic tools for plant health based on reticulon expression patterns

  • Biotechnology Applications:

    • Developing protein production systems with enhanced ER capacity

    • Creating membrane protein expression platforms optimized for difficult targets

    • Designing nanotechnology inspired by reticulon-mediated membrane shaping

    • Engineering specialized vesicles for drug or RNA delivery

  • Comparative Biology:

    • Understanding fundamental principles of membrane organization across kingdoms

    • Identifying conserved and divergent aspects of protein trafficking

    • Discovering novel membrane-shaping mechanisms with potential applications

    • Elucidating the evolution of subcellular compartmentalization

  • Plant Immunity and Food Security:

    • Creating targeted approaches to enhance specific immune pathways

    • Developing rational strategies for durable disease resistance

    • Improving understanding of receptor dynamics for agricultural applications

    • Engineering plants with fine-tuned defense responses without growth penalties

Based on findings that RTNLB1 and RTNLB2 modulate FLS2 immune activity through control of anterograde transport , and that RTNLB4 influences defense responses to Agrobacterium tumefaciens , further research into RTNLB22 may reveal additional roles in plant immunity that could be harnessed for agricultural improvement.

The translational potential of this research is substantial, particularly given the importance of plant immunity and stress responses for food security in the face of climate change and emerging pathogen threats.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.