Recombinant Arabidopsis thaliana Reticulon-like protein B2 (RTNLB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RTNLB2; BTI2; At4g11220; F8L21.10; Reticulon-like protein B2; AtRTNLB2; VirB2-interacting protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB2
Target Protein Sequence
MADEHKHEESSPNLDPAVEVVERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPK SLKSKVYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLT LLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLRE IASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEK AMAELKKQYAVLDAKVFSKIPRGPLKDKKKD
Uniprot No.

Target Background

Function
This protein plays a crucial role in Agrobacterium-mediated plant transformation through its interaction with VirB2, a major component of the T-pilus.
Gene References Into Functions
  1. RTNLB1 and RTNLB2 modulate FLS2 immune activity by regulating the anterograde transport of FLS2. PMID: 21949153
Database Links

KEGG: ath:AT4G11220

STRING: 3702.AT4G11220.1

UniGene: At.3649

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana RTNLB2?

RTNLB2 (Reticulon-like protein B2) is a membrane-associated protein that belongs to the reticulon family in Arabidopsis thaliana. It functions primarily in the endoplasmic reticulum (ER) and plays a critical role in regulating the transport of transmembrane receptors, particularly the FLAGELLIN-SENSITIVE2 (FLS2) immune receptor, to the plasma membrane. RTNLB2 works in conjunction with its homolog RTNLB1 to modulate FLS2 trafficking, which directly impacts plant immune responses to bacterial pathogens .

What is the molecular structure of RTNLB2?

RTNLB2 belongs to the reticulon protein family, which is characterized by membrane-spanning domains that adopt a specific topology in the ER membrane. Similar to RTNLB1, RTNLB2 likely has its N-terminal region, loop region, and C-terminal region residing on the cytosolic side of the ER membrane. Among reticulon proteins, the N-terminal regions are most divergent and represent a source of functional diversification through interaction with substrates . The protein contains structural elements including transmembrane domains and potentially contains Tyr-dependent sorting motifs (TDMs) that are important for its function in protein trafficking .

How is RTNLB2 expressed in Arabidopsis tissues?

While the search results don't provide specific details about RTNLB2 tissue-specific expression patterns, we know that RTNLB1 transcript accumulation increases approximately three-fold at 3 hours after flagellin (flg22) elicitation in wild-type plants but not in fls2 mutants . This suggests that RTNLB1 is induced during pattern-triggered immunity (PTI) in an FLS2-dependent manner. Given the functional similarity between RTNLB1 and RTNLB2, it's reasonable to hypothesize that RTNLB2 might also be regulated during immune responses, though this would need experimental confirmation.

How does RTNLB2 interact with the FLS2 receptor?

RTNLB2 physically interacts with the FLS2 receptor in vivo, as demonstrated through coimmunoprecipitation studies where FLS2-GFP was detected in RTNLB2-HA immunoprecipitated complexes using anti-HA antibody . This interaction likely occurs within the ER and affects the trafficking of FLS2 to the plasma membrane. Based on studies with RTNLB1, which is structurally similar, the interaction may involve specific regions such as the N-terminal Ser-rich domain, which has been shown to be critical for RTNLB1's interaction with FLS2 .

What impact does RTNLB2 deficiency have on plant immunity?

Plants lacking both RTNLB1 and RTNLB2 (rtnlb1 rtnlb2 double mutants) exhibit reduced activation of FLS2-dependent signaling pathways. This is evidenced by:

  • Decreased activity of endogenous MPK3 and MPK6 (mitogen-activated protein kinases) in response to flg22 treatment

  • Impaired transcriptional induction of early pattern-triggered immunity (PTI) markers

  • Increased susceptibility to bacterial pathogens such as Pseudomonas syringae pv tomato DC3000

Single mutants of either rtnlb1 or rtnlb2 also show impaired FLS2-dependent signaling, but to a lesser extent than the double mutant, suggesting partial functional redundancy between these two proteins .

What happens when RTNLB1/RTNLB2 levels are altered in plants?

The alteration of RTNLB1/RTNLB2 levels profoundly affects plant immune responses:

GenotypeFLS2 Membrane LocalizationMAPK ActivationPTI Marker Gene ExpressionPathogen Resistance
Wild-typeNormalNormalNormalNormal
rtnlb1 rtnlb2ReducedReducedImpairedDecreased
RTNLB1oxReduced (ER retention)Severely reducedSeverely impairedDecreased

In both loss-of-function (rtnlb1 rtnlb2) and gain-of-function (RTNLB1ox) scenarios, FLS2 accumulation at the plasma membrane is significantly affected compared to wild-type plants. Overexpression of RTNLB1 leads to FLS2 retention in the ER and affects FLS2 glycosylation (but not stability). This demonstrates that proper regulation of RTNLB1/RTNLB2 levels is crucial for optimal immune receptor trafficking and function .

How can protein-protein interactions involving RTNLB2 be studied?

Multiple complementary approaches can be used to study RTNLB2 interactions:

  • Protein microarrays: FLS2 was initially found to interact with RTNLB1 using Arabidopsis protein microarrays (FPM-5000). This high-throughput approach can identify potential interaction partners by screening the cytosolic portion of receptors against thousands of proteins .

  • Split luciferase complementation: This in vivo technique can verify protein-protein interactions in Arabidopsis using Renilla reniformis luciferase .

  • Coimmunoprecipitation (Co-IP): Using tagged versions of the proteins (e.g., RTNLB2-HA and FLS2-GFP), researchers can immunoprecipitate one protein and detect associated proteins by Western blotting. This approach confirmed the interaction between RTNLB2 and FLS2 .

  • Deletion/mutation analysis: By creating variants of RTNLB proteins lacking specific domains or containing mutations in key motifs, researchers can identify regions critical for protein interactions, as was done with RTNLB1's Ser-rich region and TDMs .

What approaches are effective for studying RTNLB2 function in FLS2 trafficking?

Several complementary approaches can be used to study RTNLB2's role in FLS2 trafficking:

  • Genetic manipulation: Creating knockout mutants (e.g., rtnlb2) or overexpression lines enables assessment of how altered RTNLB2 levels affect FLS2 function .

  • Subcellular localization studies: Using fluorescently tagged proteins (e.g., FLS2-GFP) in combination with confocal microscopy allows visualization of receptor localization in different genetic backgrounds .

  • Glycosylation analysis: Western blotting can detect changes in FLS2 glycosylation status, which indicates altered trafficking through the secretory pathway .

  • Functional immune assays: Measuring responses to flg22 treatment (MAPK activation, defense gene expression, bacterial resistance) provides insights into how RTNLB2 affects FLS2 function .

How can recombinant RTNLB2 be produced for biochemical studies?

Based on approaches used for related proteins, recombinant RTNLB2 can be produced through:

  • Expression vector selection: Arabidopsis-tagged expression collections can be employed to generate recombinant proteins with appropriate tags (HA, GFP, etc.) .

  • Protein purification strategies: Affinity purification using anti-HA antibodies has been successfully used for RTNLB proteins. For RTNLB2-HA, anti-HA antibody purification from crude plant extracts allows isolation of the protein for further analysis .

  • Stability considerations: When designing truncated versions, researchers should be aware that certain regions (like the N-terminal region in RTNLB1) may contribute to protein stability, as their removal can result in lower accumulation levels .

Does RTNLB2 interact with other immune receptors besides FLS2?

The evidence suggests RTNLB2 may have broader roles in plant immunity beyond FLS2 regulation. Studies showed that rtnlb1 rtnlb2 double mutants exhibit moderately impaired marker gene activation in response to elf18 treatment, indicating defective EFR (EF-Tu Receptor) signaling . EFR is structurally related to FLS2, and RTNLB1 has been shown to interact with EFR. This suggests RTNLB2 likely also interacts with EFR and potentially other pattern recognition receptors (PRRs), though this would require experimental confirmation through methods like coimmunoprecipitation or split luciferase complementation assays.

What molecular mechanisms determine the specificity of RTNLB2-receptor interactions?

While specific data on RTNLB2 is limited in the search results, insights from RTNLB1 suggest potential mechanisms. For RTNLB1, a Ser-rich region (LCR2) in the N-terminal tail is critical for interaction with FLS2. Additionally, Tyr-dependent sorting motifs (TDMs) in RTNLB1 also play important roles, as removing either TDM partially reverses the negative effects of excess RTNLB1 on FLS2 transport . Given the functional similarity between RTNLB1 and RTNLB2, similar structural elements may determine RTNLB2-receptor specificity. Future research could focus on:

  • Identifying specific residues or motifs in RTNLB2 that mediate receptor interactions

  • Determining whether different structural elements facilitate interactions with different receptors

  • Exploring how post-translational modifications might regulate these interactions

How do environmental factors influence RTNLB2 function?

The search results indicate that light conditions may affect the behavior of protein complexes in plant cells. While not directly referring to RTNLB2, one study assessed "changes in the PPI patterns of TCA-cycle and respiratory enzymes of mitochondria in response to a major cue for plant metabolism, the presence and absence of light" . This suggests environmental conditions can influence protein complex formation and function.

For RTNLB2 specifically, future research could explore:

  • Whether light/dark conditions alter RTNLB2 expression or localization

  • How abiotic stresses (temperature, drought, etc.) might impact RTNLB2 function

  • Whether pathogen infection changes RTNLB2 levels or activity beyond the known induction of RTNLB1 during immune responses

What are the emerging techniques for studying RTNLB2 dynamics?

Advanced techniques that could enhance RTNLB2 research include:

  • Complexome profiling: A strategy used to assess "changes in the composition and molecular mass of known mitochondrial protein complexes" could be adapted to study RTNLB2-containing complexes and how they change under different conditions.

  • Genomic prediction approaches: Methods incorporating "prior biological knowledge" have been shown to improve prediction accuracy for certain plant traits . Similar approaches could be used to predict new functions or interactions for RTNLB2 based on existing knowledge of related proteins.

  • High-resolution imaging techniques: Advanced microscopy methods could provide insights into the dynamics of RTNLB2-mediated receptor trafficking in real-time.

  • Protein interaction network analysis: Comprehensive mapping of RTNLB2 interactions could reveal new functions and regulatory mechanisms.

What are the functional similarities and differences between RTNLB1 and RTNLB2?

RTNLB1 and RTNLB2 share several functional similarities:

  • Both interact with the FLS2 receptor in vivo

  • Both are necessary for proper FLS2 trafficking to the plasma membrane

  • Mutants lacking both proteins show impaired immune responses

  • Both likely function in the ER to regulate anterograde transport of membrane proteins

Potential differences (requiring further investigation):

  • Single mutant phenotypes suggest some degree of specialization, as each single mutant shows intermediate defects compared to the double mutant

  • They may have different affinities for various receptor proteins

  • Their expression patterns in response to stimuli might differ

How can structure-function analysis of RTNLB2 inform protein engineering approaches?

Structure-function analysis of RTNLB1 identified key regions important for its function, including:

  • A Ser-rich region (LCR2) in the N-terminal tail critical for interaction with FLS2

  • Two Tyr-dependent sorting motifs (TDMs) important for regulating receptor trafficking

Similar analysis of RTNLB2 could reveal:

  • Domains that could be modified to enhance or alter receptor interactions

  • Regulatory motifs that could be targeted to modulate RTNLB2 activity

  • Regions that could be engineered to create RTNLB2 variants with novel functions or improved properties

This knowledge could inform the design of synthetic proteins or peptides that modulate plant immune responses by targeting specific steps in receptor trafficking.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.