Recombinant Arabidopsis thaliana Reticulon-like protein B3 (RTNLB3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Reticulon-Like Protein B3 (RTNLB3)

Reticulon-like proteins (RTNLBs) are a family of proteins that play a crucial role in shaping the endoplasmic reticulum (ER) in plants . Among these, Recombinant Arabidopsis thaliana Reticulon-like protein B3 (RTNLB3) is of particular interest due to its involvement in various cellular processes, including plant defense responses and Agrobacterium-mediated plant transformation .

Role in Agrobacterium-Mediated Transformation

Agrobacterium tumefaciens is a bacterium that can transfer DNA into plant cells, making it a valuable tool for plant genetic engineering . Research indicates that RTNLB3 plays a significant role in Agrobacterium-mediated plant transformation .

  • Interaction with VirB2 Protein: RTNLB3 interacts with the A. tumefaciens VirB2 protein, which is essential for the transfer of DNA into plant cells .

  • Transformation Efficiency: Overexpression of RTNLB3 enhances transgenic plant root tissue susceptibility to A. tumefaciens, increasing both transient transformation efficiency and tumor formation rates . Conversely, rtnlb3 mutants show lower GUS activity than wild-type seedlings .

Involvement in Plant Defense Responses

RTNLB3 is also implicated in plant defense responses against pathogens such as Pseudomonas syringae .

  • Susceptibility to P. syringae: Overexpression of RTNLB3 leads to enhanced susceptibility to P. syringae infection, with transgenic plants displaying more severe disease symptoms and greater cell death compared to wild-type plants .

  • Bacterial Growth: RTNLB3 overexpression plants exhibit higher viable bacterial numbers than wild-type plants following infection with P. syringae .

Protein-Protein Interactions

Mass spectrometry (MS) analysis has identified several proteins that interact with RTNLB3 . FRET-FLIM assays have validated the interaction between TCP1 and RTNLB3, confirming the reliability of the proteomics data .

Table 1: Analysis steps and number of proteins derived from MS analysis .

Analysis StepNo. of Proteins
Total (RTNLB3/RTNLB6)706 (613/621)
Minus wild-type control total (RTNLB3/RTNLB6)146 (135/126)
Proteins subjected to FRET-FLIM analysis17

Regulation by the Ubiquitin Proteasome-Pathway

RTNLB3 is regulated by the Ubiquitin Proteasome-Pathway .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RTNLB3; At1g64090; F22C12.15; Reticulon-like protein B3; AtRTNLB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB3
Target Protein Sequence
MAEEHKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSASLKTKIYRLFGREQPLHKLFG GGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSAST FIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLS KVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVM SKIPKGAFAFIKKKD
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G64090

UniGene: At.27443

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Reticulon-like protein B3 (RTNLB3)?

RTNLB3 belongs to the reticulon-like protein B (RTNLB) family in Arabidopsis thaliana. These proteins were first identified as endoplasmic reticulum (ER)-localized integral membrane proteins in mammalian neuron cells and have since been found in other eukaryotic cells, including plants . RTNLB proteins contain a carboxyl-terminal reticulon (RTN) homology domain composed of two large hydrophobic regions and a ~66 amino acid loop in between . RTNLB3, like other members of this protein family, is primarily localized in the plant endomembrane system and plays roles in ER structure formation and plant-microbe interactions .

How does RTNLB3 expression vary across different plant tissues?

RTNLB3 shows differential expression across various tissues in wild-type Arabidopsis plants. Studies have demonstrated that RTNLB1-4 and RTNLB8 transcript levels differ significantly in roots, rosette leaves, cauline leaves, inflorescence, flowers, and siliques . This tissue-specific expression pattern suggests that RTNLB3 may have specialized functions in different plant organs. For proper expression analysis, researchers should collect tissues at consistent developmental stages and use quantitative RT-PCR with appropriate reference genes to normalize expression data across tissue types.

What are the key structural characteristics of RTNLB3?

RTNLB3, similar to other reticulon family proteins, contains the characteristic reticulon homology domain (RHD) at its C-terminus. This domain features two large hydrophobic regions separated by a hydrophilic loop of approximately 66 amino acids . These hydrophobic regions are thought to form hairpin-like structures that insert into the ER membrane and contribute to membrane curvature. For structural studies, researchers should consider using recombinant protein expression systems that maintain proper protein folding, as the membrane-associated nature of RTNLB3 makes it challenging to study using conventional crystallography approaches.

Which proteins interact with RTNLB3 and how can these interactions be verified experimentally?

RTNLB3 has been shown to interact with several proteins through both yeast two-hybrid assays and in vitro GST pull-down experiments. Key interactions include:

  • Bacterial proteins: RTNLB3 interacts with VirB2, the major component of Agrobacterium tumefaciens T-pilus .

  • Other RTNLB proteins: RTNLB3 interacts with RTNLB1, RTNLB2, RTNLB4, and RTNLB8 .

These interactions can be verified through multiple complementary approaches:

  • Yeast two-hybrid assays: RTNLB3 used as bait fusion protein has been shown to interact with RTNLB2, RTNLB4, and RTNLB8, but not with RTNLB3 itself or RTNLB5-7 .

  • In vitro GST pull-down assays: GST-RTNLB3 fusion proteins interact with all five tested RTNLB proteins (RTNLB1-4 and RTNLB8) .

  • T7-tagged-RTNLB3 proteins interact with GST-VirB2 fusion protein but not with GST protein alone .

Researchers should note that different experimental approaches may yield slightly different results. For instance, more positive interaction results were obtained with GST pull-down than with yeast two-hybrid assays, possibly due to differences in protein conformation in these systems compared to native conditions in plant cells .

How does RTNLB3 contribute to Agrobacterium-mediated plant transformation?

RTNLB3 plays a significant role in Agrobacterium-mediated transformation of Arabidopsis. Experimental evidence indicates:

  • Transformation efficiency: rtnlb3 mutants show reduced transient transformation efficiency in seedlings, with GUS activities decreased by 36% to 63% in rtnlb3-1 and rtnlb3-2 single mutants compared to wild-type plants .

  • Tissue-specific effects: Interestingly, rtnlb3 mutants showed lower transformation efficiency than wild-type plants in seedling-based transformation assays but not in root-based assays . This suggests that RTNLB3's role in transformation may be tissue-dependent, with seedling tissues potentially being more sensitive to Agrobacterium infection than root tissues .

  • Enhanced susceptibility in overexpression lines: Plants overexpressing RTNLB3 showed increased susceptibility to Agrobacterium infection . This further supports RTNLB3's role in facilitating bacterial transformation.

The mechanism likely involves RTNLB3's interaction with VirB2, the major component of the T-pilus of Agrobacterium, which may facilitate the initial contact between the bacterium and the plant cell.

What are the most effective methods for generating and validating RTNLB3 overexpression plants?

Generating effective RTNLB3 overexpression plants requires careful consideration of several methodological aspects:

  • Promoter selection: Using a strong constitutive promoter such as the double CaMV 35S promoter has proven effective for RTNLB3 overexpression .

  • Protein tagging: Including epitope tags such as T7 can facilitate protein detection. Studies have successfully generated both untagged RTNLB3 and T7-tagged-RTNLB3 overexpression plants .

  • Validation methods:

    • Transcript level verification: RT-qPCR analysis can confirm increased RTNLB3 transcript levels. Previous studies have achieved 1.2- to 1.7-fold increases in RTNLB3 transcript levels in overexpression lines .

    • Protein verification: Protein gel blot analysis using anti-T7-tag antibody can demonstrate accumulation of recombinant proteins in transgenic plants .

    • Functional verification: Testing increased susceptibility to Agrobacterium infection can serve as a functional validation of RTNLB3 overexpression .

  • Control selection: Include appropriate controls such as wild-type plants and, if possible, rtnlb3 mutants for comprehensive analysis and comparison.

What experimental systems are most suitable for studying RTNLB3 protein interactions?

Based on the research findings, multiple complementary approaches should be used to comprehensively study RTNLB3 protein interactions:

  • Yeast two-hybrid assays:

    • Advantages: Allow for in vivo testing of protein interactions in a eukaryotic system.

    • Limitations: May yield false negatives due to protein conformation issues or membrane association.

    • Implementation notes: Both plate-based and liquid-based β-galactosidase activity assays should be performed for quantitative assessment of interaction strengths .

  • In vitro GST pull-down assays:

    • Advantages: Directly test protein-protein interactions with purified components.

    • Setup: Use GST fusion proteins and T7-tagged versions of target proteins.

    • Detection: Western blotting with appropriate antibodies.

    • Results interpretation: GST pull-down assays have detected more positive interactions of RTNLB3 with VirB2 and other RTNLB proteins than yeast two-hybrid assays .

  • In planta confirmation:

    • Co-immunoprecipitation from plant extracts expressing tagged versions of proteins.

    • Bimolecular fluorescence complementation to visualize interactions in plant cells.

For reliable results, researchers should be aware that different assay systems may yield varying results due to differences in protein conformations. The native membrane-associated nature of RTNLB proteins in plants may not be perfectly replicated in heterologous systems .

How does RTNLB3 affect plant susceptibility to bacterial pathogens?

RTNLB3 appears to play a significant role in plant-pathogen interactions beyond just Agrobacterium transformation:

  • Effect on P. syringae infection:

    • RTNLB3 overexpression plants show greater susceptibility to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000) infection .

    • These plants display:

      • Higher bacterial numbers from day 1 post-infection

      • More severe disease symptoms and chlorotic haloes at 5 days post-infection

      • Greater cell death compared to wild-type plants

  • Specificity of the effect:

    • The enhanced susceptibility is specific to virulent bacteria, as no difference in bacterial growth or visible disease symptoms was observed when plants were infected with the hrcC mutant (type III secretion system-defective bacteria) .

  • Potential mechanisms:

    • The enhanced susceptibility may be related to RTNLB's potential role in regulating the export of pattern recognition receptors (PRRs) to the plasma membrane during pathogen infection, similar to what has been suggested for RTNLB1 and RTNLB2 with FLS2 (the PRR for bacterial flagellin) .

This indicates that RTNLB3 may have broader roles in plant immunity beyond Agrobacterium transformation, possibly through modulation of membrane trafficking or PRR localization.

What is the relationship between RTNLB3 and endoplasmic reticulum structure?

RTNLB3, like other members of the reticulon family, appears to be involved in endoplasmic reticulum (ER) modeling and structure formation:

  • Localization: RTNLB proteins, including RTNLB3, are primarily localized in plant endomembrane systems, particularly the ER .

  • Functional evidence:

    • RTNLBs and ROOT HAIR DEFECTIVE 3 (RHD3) play significant roles in ER tubular structure formation .

    • RTNLB1-4 and RTNLB13 can interact with each other and help with ER tubular structure formation .

    • RTNLB3 interactions with other RTNLBs in yeast and in vitro support its potential role in ER modeling .

  • Structural basis:

    • The reticulon homology domain (RHD) with its hydrophobic regions can insert into the ER membrane and induce membrane curvature, contributing to the formation and maintenance of tubular ER structures.

The dual role of RTNLB3 in both pathogen interactions and ER structure suggests potential connections between membrane organization and plant-microbe interactions that warrant further investigation.

How might tissue-specific expression of RTNLB3 affect experimental outcomes in transformation studies?

The differential expression of RTNLB3 across plant tissues has important implications for transformation studies:

  • Observed tissue-specific effects:

    • rtnlb3 mutants show reduced transformation efficiency in seedling-based assays but not in root-based assays .

    • This suggests seedling tissues may be more sensitive to Agrobacterium infection than root tissues, and/or RTNLB3 has tissue-specific roles .

  • Experimental design considerations:

    • Tissue selection: Researchers should carefully select appropriate tissues for transformation studies based on RTNLB3 expression levels.

    • Developmental stage: Consider the developmental stage of tissues, as RTNLB expression may vary throughout development.

    • Transformation protocol adjustment: Protocols may need to be optimized differently for different tissues when working with rtnlb3 mutants or RTNLB3 overexpression lines.

  • Data interpretation:

    • Results should be interpreted in the context of tissue-specific expression patterns.

    • Negative results in one tissue type do not necessarily indicate lack of RTNLB3 involvement in other tissues.

This tissue-specific functionality highlights the importance of comprehensive experimental designs that include multiple tissue types when studying RTNLB3's role in transformation.

What are the potential mechanisms for the observed differences between in vitro and in vivo protein interaction studies with RTNLB3?

The discrepancies observed between different protein interaction detection methods for RTNLB3 raise important considerations for research methodology:

  • Observed differences:

    • More positive interaction results of RTNLB3 with VirB2 and other RTNLB proteins were obtained with GST pull-down assays than with yeast two-hybrid assays .

    • Some interactions were detected only in one direction in yeast two-hybrid assays (e.g., RTNLB2 bait with RTNLB8 prey showed interaction, but RTNLB8 bait with RTNLB2 prey did not) .

  • Potential mechanisms explaining these differences:

    • Protein conformation: Different fusion versions of RTNLB proteins used in yeast two-hybrid and GST pull-down assays may not form the same conformation as native RTNLB protein in plant cells .

    • Membrane association: RTNLB proteins are membrane proteins mainly localized in plant endomembrane systems, which may not be properly represented in soluble protein assays .

    • Fusion protein orientation: The placement of tags or fusion domains may differently affect protein folding or exposure of interaction interfaces.

    • Post-translational modifications: Different experimental systems may not recapitulate the same post-translational modifications present in planta.

  • Methodological recommendations:

    • Use multiple complementary approaches to study protein interactions.

    • Consider membrane-based or split-ubiquitin yeast two-hybrid systems for membrane proteins.

    • Validate key interactions in planta when possible.

    • Report interaction strengths quantitatively using methods like β-galactosidase activity assays .

Understanding these methodological considerations is crucial for accurate interpretation of protein interaction data involving RTNLB3 and other membrane-associated proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.