Recombinant Arabidopsis thaliana Reticulon-like protein B4 (RTNLB4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RTNLB4; BTI3; At5g41600; MBK23.13; Reticulon-like protein B4; AtRTNLB4; VirB2-interacting protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB4
Target Protein Sequence
MVEDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVH KVLGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWS NACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGL WVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVL RKVISKIPRGALNKKKD
Uniprot No.

Target Background

Function
Plays a role in Agrobacterium-mediated plant transformation through interaction with VirB2, the primary component of the T-pilus.
Database Links

KEGG: ath:AT5G41600

STRING: 3702.AT5G41600.1

UniGene: At.8344

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of RTNLB4 in Arabidopsis thaliana?

RTNLB4 belongs to one of three subfamilies of reticulon-like proteins in Arabidopsis that can be distinguished based on structural organization and sequence homology. Like other reticulon proteins, RTNLB4 is characterized by a conserved reticulon homology domain (RHD), which is responsible for its membrane association and tubule-forming properties. The structural similarity between AtRTNLB proteins and mammalian reticulons suggests conservation of basic cellular functions across kingdoms .

Where is RTNLB4 localized within plant cells?

RTNLB4 demonstrates a specific subcellular localization pattern in plant cells. Fluorescent protein tagging studies have confirmed that RTNLB4 is predominantly associated with the endoplasmic reticulum (ER). Unlike some other reticulon family members that are restricted to tubular ER, RTNLB4 has been found in both tubular ER structures and lamellar ER cisternae. Notably, RTNLB4 has also been observed in ER tubules that maintain close association with chloroplasts, suggesting a potential role in ER-chloroplast communication or interaction .

How does RTNLB4 compare to other reticulon-like proteins in Arabidopsis?

The Arabidopsis genome encodes multiple reticulon-like proteins that share structural similarities but exhibit distinct localization patterns and potentially different functions. For example, while both AtRTNLB2 and AtRTNLB4 are located in the tubular ER, AtRTNLB4 demonstrates additional localization to lamellar ER cisternae and chloroplast-associated ER regions. This differential localization suggests specialized functions for RTNLB4 beyond the basic ER-shaping role common to reticulons .

What is the proposed function of RTNLB4 in endoplasmic reticulum organization?

Based on structural similarities with mammalian and yeast reticulons, RTNLB4 is believed to participate in shaping and maintaining the tubular endoplasmic reticulum network. Reticulons typically insert into the ER membrane in a hairpin-like manner, creating membrane curvature through hydrophobic wedging and scaffolding mechanisms. RTNLB4's presence in both tubular and lamellar ER structures suggests it may have a role in regulating ER morphology transitions or in specialized ER subdomains .

How does RTNLB4 relate to endomembrane trafficking in plant cells?

RTNLB4, like other reticulon-like proteins in Arabidopsis, is involved in endomembrane trafficking pathways. These pathways are crucial for various cellular processes including secretion, endocytosis, and protein quality control. The specific role of RTNLB4 in these trafficking events remains under investigation, but other family members have been implicated in regulating the movement of plasma membrane proteins from the ER, suggesting RTNLB4 may perform similar functions .

What experimental approaches are used to study RTNLB4 localization in plant cells?

Researchers typically employ fluorescent protein fusion techniques to visualize RTNLB4 localization. This involves:

  • Generating constructs that fuse fluorescent proteins (GFP, YFP, etc.) to either the N- or C-terminus of RTNLB4

  • Introducing these constructs into plant cells via transformation

  • Visualizing the resulting fusion protein using confocal microscopy

  • Confirming localization through co-localization studies with known ER markers

Care must be taken when designing these fusion proteins, as the topology of reticulon proteins means that improper fusion placement can disrupt protein function or localization .

How does RTNLB4 influence Agrobacterium tumefaciens infection in Arabidopsis?

RTNLB4 plays a significant role in determining plant susceptibility to Agrobacterium tumefaciens infection. Experimental evidence shows that:

  • Plants with T-DNA insertions in the RTNLB4 gene (rtnlb4 mutants) display significantly decreased susceptibility to A. tumefaciens infection

  • In root transformation assays, tumor formation rates decreased more than 4-fold in rtnlb4 mutants compared to wild-type plants

  • Transient transformation rates reduced by 53.5% in root tissues and by more than 95.6% in seedling tissues of rtnlb4 mutants

  • Conversely, overexpression of RTNLB4 in transgenic plants resulted in hypersusceptibility to A. tumefaciens transformation, with transformation rates enhanced more than 1.5-fold compared to wild-type plants

These findings strongly indicate that RTNLB4 facilitates successful A. tumefaciens infection processes .

What molecular interactions occur between RTNLB4 and Agrobacterium components?

RTNLB4 has been shown to interact directly with VirB2, a major component of the A. tumefaciens T-pili. This interaction is part of the molecular dialogue between plant and pathogen during infection. VirB2 is a component of the Type IV secretion system that A. tumefaciens uses to deliver effector proteins and T-DNA into plant cells. The physical interaction between RTNLB4 and VirB2 suggests that RTNLB4 may influence the efficiency of T-DNA transfer by affecting recognition, attachment, or internalization processes during infection .

How does RTNLB4 expression respond to bacterial elicitors?

RTNLB4 gene expression is significantly induced by bacterial elicitors, particularly the elf18 peptide derived from bacterial elongation factor Tu (EF-Tu). Experimental data shows:

  • Treatment of Arabidopsis seedlings with 10 μM elf18 peptide results in a more than 4-fold increase in RTNLB4 mRNA levels after just 10 minutes

  • RTNLB4 mRNA levels increase further (8-fold) after 120 minutes of elf18 treatment

  • Expression continues to increase through 360 minutes of treatment

This rapid transcriptional response suggests that RTNLB4 is part of the early plant response to bacterial pathogens .

How does RTNLB4 affect defense-related gene expression during pathogen challenge?

RTNLB4 appears to modulate defense-related gene expression in Arabidopsis. When plants are treated with bacterial elicitors like elf18:

  • Plants overexpressing RTNLB4 (RTNLB4 O/E) show significantly reduced induction of defense-related genes including:

    • FRK1 (Flg22-induced receptor-like kinase 1)

    • PR1 (Pathogenesis-related protein 1)

    • WRKY22 and WRKY29 (WRKY transcription factors)

    • MPK3 and MPK6 (Mitogen-activated protein kinases)

  • This attenuated defense response correlates with increased susceptibility to Agrobacterium infection in RTNLB4 O/E plants

  • Surprisingly, rtnlb4 mutants also show reduced induction of some defense-related genes despite being more resistant to Agrobacterium infection

This complex relationship suggests RTNLB4 may influence multiple aspects of defense signaling .

What is the relationship between RTNLB4 and PAMP-triggered immunity in plants?

RTNLB4 appears to modulate plant responses to Pathogen-Associated Molecular Patterns (PAMPs). Experimental evidence indicates:

  • RTNLB4 participates in elf18 peptide-induced defense responses

  • Pretreatment with elf18 peptide decreases Agrobacterium-mediated transient expression efficiency more dramatically in wild-type seedlings than in RTNLB4 O/E transgenic plants

  • This suggests that RTNLB4 overexpression dampens PAMP-triggered immunity (PTI) responses

  • RTNLB4 also participates in responses to VirB2 peptides, which can induce defense gene expression in wild-type plants but not in efr-1 and bak1 mutants

These findings position RTNLB4 as a modulator of PAMP perception or downstream signaling in plant immunity .

How does RTNLB4 influence plant responses to VirB2 peptides from Agrobacterium?

RTNLB4 modulates plant responses to specific peptides derived from the Agrobacterium VirB2 protein:

  • Pretreatment with VirB2 peptides (particularly S111-T58 and I63-I80) decreases transient T-DNA expression in wild-type seedlings

  • This inhibitory effect is reduced in RTNLB4 O/E transgenic seedlings

  • VirB2 peptides induce expression of defense-related genes in wild-type plants

  • This induction is reduced in RTNLB4 O/E plants

  • VirB2 peptides fail to induce defense responses in efr-1 and bak1 mutants, suggesting involvement of these immune receptors

These findings suggest that RTNLB4 may influence how plants perceive and respond to Agrobacterium VirB2, potentially by modulating receptor-mediated recognition events .

What genetic approaches are effective for studying RTNLB4 function in Arabidopsis?

Several genetic approaches have proven valuable for RTNLB4 functional studies:

  • T-DNA insertion mutants:

    • Analysis of rtnlb4-1, rtnlb4-2, and rtnlb4-3 mutants with insertions in different regions of the RTNLB4 gene

    • Quantification of RTNLB4 expression levels using qPCR to confirm knockdown (13.3% to 23.3% of wild-type levels)

    • Phenotypic assessment of mutants in response to Agrobacterium infection

  • Overexpression studies:

    • Generation of transgenic plants expressing RTNLB4 or T7-tagged-RTNLB4 under the control of the CaMV 35S promoter

    • Confirmation of overexpression by qPCR and protein gel blot analysis

    • Assessment of Agrobacterium infection efficiency in these lines

  • Reporter gene assays:

    • Use of GUS reporter systems to quantify T-DNA transfer and expression efficiency

What protocols are recommended for analyzing RTNLB4's role in Agrobacterium-mediated transformation?

To assess RTNLB4's influence on Agrobacterium transformation efficiency, researchers typically employ:

  • Root-based transformation assays:

    • Inoculation of root segments with A. tumefaciens

    • Assessment of stable transformation through tumor formation rates

    • Quantification of transient transformation using reporter gene expression

  • Seedling-based transformation assays:

    • Co-cultivation of whole seedlings with A. tumefaciens carrying reporter constructs

    • Measurement of reporter gene activity (e.g., GUS staining or luciferase assays)

    • Comparison of transformation efficiency between wild-type, mutant, and overexpression lines

  • Bacterial concentration optimization:

    • Use of lower bacterial concentrations (10⁴-10⁶ cfu/mL) to better distinguish differences between genotypes

    • Standardization of infection conditions including co-cultivation time and temperature

How can researchers effectively measure RTNLB4's impact on defense gene expression?

To quantify RTNLB4's effects on defense-related gene expression, the following approaches are recommended:

  • Quantitative RT-PCR analysis:

    • Treatment of seedlings with elicitors (e.g., 10 μM elf18 peptide)

    • RNA extraction at multiple time points (e.g., 0, 10, 30, 60, 120, 360 minutes after treatment)

    • qPCR analysis of defense marker genes including FRK1, PR1, WRKY22, WRKY29, MPK3, and MPK6

    • Normalization to appropriate reference genes

    • Comparison between wild-type, rtnlb4 mutants, and RTNLB4 O/E plants

  • Defense response phenotyping:

    • Assessment of seedling growth inhibition in response to elicitors

    • Measurement of reactive oxygen species (H₂O₂) accumulation

    • Analysis of callose deposition

This combinatorial approach provides a comprehensive view of how RTNLB4 influences defense signaling .

What is the molecular mechanism by which RTNLB4 influences plant defense responses?

The precise molecular mechanism through which RTNLB4 modulates defense signaling remains incompletely understood. Current evidence suggests several possibilities that require further investigation:

  • RTNLB4 may influence the trafficking or localization of pattern recognition receptors (PRRs) like EFR that perceive bacterial PAMPs

  • RTNLB4 could modulate signaling complex formation, similar to how other family members affect FLS2 translocation from ER to plasma membrane

  • The protein might influence calcium signaling or other second messenger systems involved in defense activation

  • RTNLB4's localization at ER-chloroplast contact sites might affect signal integration between these organelles during immune responses

Addressing these hypotheses requires detailed biochemical and cell biological approaches to track protein movements and interactions during pathogen challenge .

How does the seemingly contradictory phenotype of rtnlb4 mutants relate to RTNLB4 function?

An intriguing paradox exists in RTNLB4 research: rtnlb4 mutants show reduced susceptibility to Agrobacterium infection despite having lower levels of defense gene induction similar to RTNLB4 overexpression plants. Several hypotheses might explain this contradiction:

  • RTNLB4 may have direct roles in facilitating T-DNA transfer or integration that are separate from its effects on defense signaling

  • The protein might influence specific defense responses not captured by the marker genes typically analyzed

  • Temporal dynamics of defense responses might differ between mutants and overexpression lines

  • RTNLB4 might affect cellular processes required for Agrobacterium infection independent of classical defense pathways

Further research using systems biology approaches and detailed time-course analyses might help resolve this apparent contradiction .

What potential applications might arise from understanding RTNLB4 function in plant-pathogen interactions?

Understanding RTNLB4's role in plant-pathogen interactions could lead to several practical applications:

  • Enhanced Agrobacterium-mediated transformation protocols for recalcitrant plant species by modulating RTNLB4 expression

  • Development of novel strategies to enhance plant resistance to bacterial pathogens by targeting RTNLB4-dependent processes

  • Improvement of plant immune responses through precise engineering of RTNLB4 or related family members

  • Better understanding of ER dynamics during pathogen challenge, potentially revealing new targets for disease resistance

Further characterization of the mechanistic details of RTNLB4 function will be crucial for realizing these potential applications .

How do the functions of RTNLB4 compare with other RTNLB family members in Arabidopsis?

The Arabidopsis genome encodes multiple RTNLB proteins with both overlapping and distinct functions:

RTNLB Family MemberLocalizationKnown FunctionsAgrobacterium Interaction
RTNLB1Tubular ERER shaping, FLS2 translocationInteracts with VirB2
RTNLB2Tubular ERER shaping, FLS2 translocationInteracts with VirB2
RTNLB3ER membraneER morphology when overexpressedNot reported
RTNLB4Tubular ER, lamellar ER cisternae, chloroplast-associated ERDefense response modulationInteracts with VirB2
RTNLB13Tubular ERER tubule formationNot reported

While RTNLB1, RTNLB2, and RTNLB4 all interact with Agrobacterium VirB2, RTNLB4 has unique localization patterns and potentially specialized functions in defense signaling pathways compared to other family members .

What structural features distinguish RTNLB4 from other reticulon proteins?

The structural organization of reticulon proteins contributes to their functional specificity. While all reticulons share a conserved reticulon homology domain (RHD), variations exist that likely drive functional specialization:

  • The specific length and sequence of the N-terminal region, which can vary significantly between family members

  • The precise spacing and composition of transmembrane domains within the RHD

  • The C-terminal tail region, which may contain regulatory motifs or interaction domains

  • The presence of specific post-translational modification sites

Detailed structural analysis of RTNLB4 compared to other family members would provide insights into its unique functional properties .

What technical challenges exist in purifying recombinant RTNLB4 for biochemical studies?

Producing and purifying recombinant RTNLB4 presents several technical challenges:

  • As a membrane protein with multiple transmembrane domains, RTNLB4 is difficult to express in soluble form

  • The protein's tendency to induce membrane curvature may cause toxicity when overexpressed in bacterial systems

  • Maintaining proper folding and topology during extraction from membranes requires careful optimization of detergents and buffer conditions

  • The protein may require specific lipid environments to maintain its native structure and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.