Recombinant Arabidopsis thaliana Reticulon-like protein B5 (RTNLB5)

Shipped with Ice Packs
In Stock

Description

Introduction

Reticulon-like proteins (RTNLBs) are a family of proteins involved in endomembrane-related processes in plant cells, including intracellular transport, vesicle formation, and membrane curvature . Arabidopsis thaliana, a model organism for plant research, contains several RTNLB proteins. While the request specifically mentions RTNLB5, it is important to note that research has focused more on other RTNLB proteins such as RTNLB1, RTNLB3, and RTNLB8, particularly in the context of Agrobacterium-mediated plant transformation .

Role of RTNLB Proteins in Agrobacterium-Mediated Transformation

Agrobacterium tumefaciens genetically transforms eukaryotic cells by transferring a defined region of its tumor-inducing (Ti) plasmid, known as transfer DNA (T-DNA), into plant cells . This process involves a type IV secretion system (T4SS), including the T-pilus and transmembrane protein complex . Certain RTNLB proteins interact with VirB2, a major component of the T-pilus, suggesting their involvement in the transformation process .

RTNLB3 and RTNLB8: Close Relatives of RTNLB5

Research indicates that RTNLB3 and RTNLB8 interact with VirB2 in vitro . Root-based A. tumefaciens transformation assays with Arabidopsis rtnlb3 or rtnlb5-10 single mutants revealed that the rtnlb8 mutant is resistant to A. tumefaciens infection . Additionally, rtnlb3 and rtnlb8 mutants show reduced transient transformation efficiency in seedlings . Overexpression of RTNLB3 or 8 in transgenic plants increases susceptibility to both A. tumefaciens and Pseudomonas syringae infection .

Expression Patterns of RTNLB Proteins

Transcript levels of RTNLB1-4 and 8 vary across different tissues in wild-type plants, including roots, rosette leaves, cauline leaves, inflorescence, flowers, and siliques . This suggests that different RTNLB proteins may have specialized roles depending on the tissue type .

Functional Domains and Interactions

RTNLB proteins contain a carboxyl-terminal reticulon (RTN) homology domain composed of two large hydrophobic regions and a loop . This domain is crucial for protein interactions and membrane shaping . RTN proteins can interact with themselves or recruit other proteins to form complexes . They participate in endomembrane-related processes, including intracellular transport, vesicle formation, and membrane curvature in mammalian, yeast, and plant cells .

RNA-Binding Proteins in Arabidopsis thaliana

A study employing interactome capture techniques identified 1,145 different proteins as Arabidopsis RNA-binding proteins (RBPs) . These proteins play essential roles in RNA fate from synthesis to decay . The study noted specific subsets of RBPs in cultured cells and leaves, revealing that RBPs are species and tissue-specific .

Data Table: Expression Levels of RTNLB Genes in Different Tissues (Hypothetical)

Since specific data for RTNLB5 expression levels across different tissues is limited, the following table is a hypothetical representation based on the general expression patterns observed for other RTNLB genes .

TissueRTNLB5 Expression Level (Relative)
RootsMedium
Rosette LeavesLow
Cauline LeavesMedium
InflorescenceHigh
FlowersHigh
SiliquesMedium

Note: This table is for illustrative purposes only and does not represent actual experimental data.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
RTNLB5; At2g46170; T3F17.18; Reticulon-like protein B5; AtRTNLB5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB5
Target Protein Sequence
MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSAVKAKIYRMFGREKPVH KVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWS NAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGL WIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVL SKIPIASLKAKAKLG
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G46170

STRING: 3702.AT2G46170.1

UniGene: At.13080

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and localization of RTNLB5 in Arabidopsis thaliana?

RTNLB5 belongs to the reticulon-like protein family in Arabidopsis, characterized by a carboxyl-terminal reticulon (RTN) homology domain. This domain consists of two large hydrophobic regions separated by a ~66 amino acid loop. Like other RTN proteins, RTNLB5 is likely membrane-anchored to the endoplasmic reticulum (ER) . RTN proteins were first identified in the central nervous system and neuroendocrine cells of mammals, with the RTN1 protein being the first characterized member of this family . In plants, these proteins participate in endomembrane-related processes including intracellular transport, vesicle formation, and membrane curvature .

How does RTNLB5 differ from other RTNLB family members in Arabidopsis?

While the search results don't provide comprehensive differential information specifically for RTNLB5, they do highlight a key functional difference: RTNLB5-7 proteins showed no interactions with RTNLB1-8 proteins in yeast two-hybrid assays, unlike other family members such as RTNLB1, 2, 3, 4, and 8 which demonstrate protein-protein interactions . This suggests RTNLB5 may have distinct functional roles compared to other RTNLBs. Research has more extensively characterized RTNLB1, 2, 3, 4, and 8, which interact with the Agrobacterium tumefaciens VirB2 protein and participate in bacterial infection processes .

What expression patterns does RTNLB5 exhibit across different Arabidopsis tissues?

The available search results indicate that RTNLB family members show differential expression across plant tissues. For context, RTNLB1-4 and 8 transcript levels differ in roots, rosette leaves, cauline leaves, inflorescence, flowers, and siliques of wild-type plants . This tissue-specific expression pattern suggests specialized functions in different plant organs. While specific RTNLB5 expression patterns aren't detailed in the provided search results, researchers would typically analyze tissue-specific expression through methods such as RT-PCR, RNA-seq, or promoter-reporter gene fusions to fully characterize expression profiles.

What is known about the T-DNA insertion mutants of RTNLB5?

T-DNA insertion homozygous mutants have been identified for RTNLB5, with the insertion site mainly located in the 3' or 5' untranslated region (UTR) of the RTNLB5 gene . These mutants provide valuable tools for studying the function of RTNLB5 through loss-of-function approaches. The availability of characterized T-DNA insertion lines allows researchers to investigate phenotypic consequences of RTNLB5 disruption and compare them with other rtnlb mutants for functional analysis.

How should researchers design experiments to investigate RTNLB5's role in plant-microbe interactions?

To investigate RTNLB5's potential role in plant-microbe interactions, researchers should design experiments based on established protocols for related RTNLBs, while incorporating appropriate controls. A comprehensive experimental approach would include:

  • Infection assays with T-DNA insertion mutants: Following the methodology used for other rtnlb mutants, researchers should conduct both root-based and seedling-based Agrobacterium tumefaciens infection assays with rtnlb5 mutant plants . Transformation efficiency should be compared to wild-type plants.

  • Overexpression studies: Generate RTNLB5-overexpressing transgenic lines to assess if they show altered susceptibility to bacterial infections, similar to what has been observed with RTNLB3 or RTNLB8 overexpression plants that showed enhanced susceptibility to both A. tumefaciens and Pseudomonas syringae infections .

  • Protein-protein interaction studies: Although previous studies showed no interactions between RTNLB5 and other RTNLB proteins in yeast, researchers should test for direct interactions with bacterial proteins (particularly VirB2) using methods such as:

    • In vitro pull-down assays with recombinant proteins

    • Yeast two-hybrid assays

    • BiFC (Bimolecular Fluorescence Complementation) in planta

  • Cell biology approaches: Employ confocal microscopy with fluorescently-tagged RTNLB5 to track subcellular localization during bacterial infection.

Experimental design should follow established protocols from the literature, with appropriate randomization and statistical analysis as outlined in advanced experimental design references .

What is the current understanding of RTNLB5's involvement in membrane structure and dynamics?

While the search results don't provide specific information about RTNLB5's role in membrane structure, we can infer potential functions based on knowledge of the RTN protein family. RTN proteins are generally involved in various endomembrane-related processes, including intracellular transport, vesicle formation, and membrane curvature .

To investigate RTNLB5's specific role in membrane dynamics, researchers should consider:

  • Ultrastructural analysis: Using transmission electron microscopy to examine ER morphology in rtnlb5 mutants compared to wild-type plants.

  • Membrane protein dynamics: Employing fluorescence recovery after photobleaching (FRAP) to analyze protein mobility in membranes when RTNLB5 is absent or overexpressed.

  • Membrane isolation and proteomics: Isolating membrane fractions and analyzing protein composition to identify RTNLB5 interaction partners and affected membrane proteins.

  • Lipid analysis: Examining whether RTNLB5 affects membrane lipid composition or domain organization.

These approaches would help elucidate RTNLB5's specific contributions to membrane structure and function in plant cells.

How do researchers purify and characterize recombinant RTNLB5 protein for in vitro studies?

To obtain pure, functional recombinant RTNLB5 for in vitro studies, researchers should consider the following methodological approach:

  • Expression system selection: Due to the membrane-associated nature of RTNLBs, selecting an appropriate expression system is critical. Options include:

    • Bacterial systems: E. coli with specialized tags and solubilization methods

    • Eukaryotic systems: Yeast, insect cells, or plant-based expression systems that may provide better post-translational modifications

  • Construct design:

    • Include appropriate affinity tags (His, GST, or MBP) for purification

    • Consider expressing soluble domains separately if full-length protein proves difficult

    • Codon optimization for the chosen expression system

  • Membrane protein solubilization and purification:

    • Use mild detergents (DDM, LDAO, or digitonin) to extract membrane proteins

    • Employ affinity chromatography followed by size-exclusion chromatography

    • Consider nanodiscs or liposomes for maintaining native-like environment

  • Functional characterization:

    • Circular dichroism to analyze secondary structure

    • Binding assays with potential interacting partners

    • In vitro membrane remodeling assays

This approach follows standard biochemical methods for membrane protein purification while addressing the specific challenges of RTNLBs.

What techniques should be employed to analyze RTNLB5 interactions with other cellular proteins?

To comprehensively analyze RTNLB5 interactions with other cellular proteins, researchers should utilize multiple complementary approaches:

  • In planta approaches:

    • Co-immunoprecipitation (Co-IP) using antibodies against RTNLB5 or epitope-tagged versions

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in living cells

    • Förster Resonance Energy Transfer (FRET) for detecting proximity of proteins

    • Proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling

  • In vitro approaches:

    • Pull-down assays with recombinant or purified proteins

    • Surface Plasmon Resonance (SPR) to determine binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of interactions

  • High-throughput screening:

    • Yeast two-hybrid screening against Arabidopsis cDNA libraries

    • Protein microarrays similar to those used to identify interactions between RTNLBs and FLS2

    • Mass spectrometry-based interactome analysis after affinity purification

  • Computational approaches:

    • Prediction of interaction partners based on structural models

    • Network analysis based on co-expression data

These methods should be used in combination, as each has distinct strengths and limitations when studying membrane-associated proteins like RTNLB5.

What statistical approaches are most appropriate for analyzing RTNLB5 mutant phenotypes?

When analyzing phenotypes of RTNLB5 mutants compared to wild-type or other controls, researchers should employ rigorous statistical methods:

  • Experimental design considerations:

    • Use randomized complete block designs (RCBD) or incomplete block designs depending on experimental constraints

    • Include sufficient biological and technical replicates based on power analysis

    • Consider environmental factors that might influence phenotypes

  • Statistical tests for phenotypic analysis:

    • For continuous variables: ANOVA followed by appropriate post-hoc tests (Tukey's HSD, Dunnett's test for comparisons to control)

    • For count data or non-normal distributions: Generalized linear models with appropriate distributions

    • For infection susceptibility studies: Survival analysis methods may be appropriate

  • Multi-factorial analysis:

    • When examining interactions between RTNLB5 mutation and other factors (e.g., pathogen strain, environmental conditions), use multi-way ANOVA or mixed-effects models

    • Consider row-column designs for complex experiments with multiple factors

  • Reporting statistical results:

    • Include measures of central tendency and dispersion

    • Report exact p-values and confidence intervals

    • Present data in clear tables and figures with appropriate error bars

These approaches align with advanced experimental design principles and ensure robust interpretation of experimental results .

How should researchers design complementation studies to confirm RTNLB5 function?

To confirm that phenotypes observed in rtnlb5 mutants are specifically due to the loss of RTNLB5 function, researchers should design comprehensive complementation studies:

  • Construct design for complementation:

    • Native promoter-driven expression: Clone the complete RTNLB5 gene including its native promoter region (typically 1-2 kb upstream of start codon)

    • Alternative: Use a constitutive promoter (e.g., 35S) or tissue-specific promoters based on known expression patterns

    • Consider adding small epitope tags that don't interfere with protein function for detection

  • Controls and variations:

    • Include both wild-type RTNLB5 and site-directed mutants with alterations in key functional domains

    • Use empty vector transformants as negative controls

    • Consider cross-complementation with other RTNLB family members to test functional redundancy

  • Transformation and selection:

    • Transform the rtnlb5 mutant background using Agrobacterium-mediated transformation

    • Generate multiple independent transgenic lines (minimum 3-5) to account for position effects

    • Confirm transgene expression levels by RT-qPCR and protein levels by western blotting

  • Phenotypic analysis:

    • Test whether the complemented lines restore wild-type phenotypes in all assays where the mutant showed differences

    • Include dose-response analyses when relevant (e.g., for pathogen susceptibility)

    • Analyze multiple generations to ensure stable complementation

This comprehensive approach will provide robust evidence for the specific function of RTNLB5 and help distinguish its role from other family members.

How does RTNLB5 function compare across different plant species?

To understand the conservation and divergence of RTNLB5 function across plant species, researchers should conduct comparative analyses:

  • Phylogenetic analysis:

    • Identify RTNLB5 orthologs in other plant species through sequence similarity searches

    • Construct phylogenetic trees to understand evolutionary relationships

    • Analyze selection pressures on different domains to identify functionally important regions

  • Comparative expression analysis:

    • Compare tissue-specific expression patterns of RTNLB5 orthologs across species

    • Analyze expression responses to biotic and abiotic stresses

  • Functional complementation:

    • Test whether RTNLB5 orthologs from other species can complement Arabidopsis rtnlb5 mutants

    • Express Arabidopsis RTNLB5 in other plant species to test functional conservation

  • Structural comparison:

    • Compare predicted protein structures of RTNLB5 orthologs

    • Identify conserved motifs and variable regions

This comparative approach will provide insights into the evolutionary conservation of RTNLB5 function and help identify species-specific adaptations.

What is the current understanding of RTNLB5 in plant immunity responses?

While the search results don't provide specific information about RTNLB5's role in immunity, they do mention related RTNLBs in immune contexts, suggesting potential research directions:

  • Context from related RTNLBs:

    • RTNLB1 and RTNLB2 interact with FLAGELLIN-SENSITIVE2 (FLS2), a pattern recognition receptor for bacterial flagellin

    • The rtnlb1, rtnlb2 double mutant and RTNLB1 overexpression plants show increased susceptibility to Pseudomonas syringae infection and decreased FLS2-mediated immunity responses

    • RTNLB1 and RTNLB2 appear to control trafficking of the FLS2 protein to the plasma membrane

  • Research approaches to investigate RTNLB5 in immunity:

    • Test rtnlb5 mutant responses to various pathogens and pathogen-associated molecular patterns (PAMPs)

    • Investigate potential interactions between RTNLB5 and known immune receptors

    • Examine RTNLB5 expression changes during pathogen infection

    • Create and test double or higher-order mutants of RTNLB5 with other immunity-related genes

  • Potential mechanisms:

    • Membrane protein trafficking similar to the role of RTNLB1/2 in FLS2 trafficking

    • ER structure modulation during immune responses

    • Potential roles in plasmodesmata regulation, which impacts cell-to-cell signaling during immunity

Researchers should design experiments that test these potential roles while acknowledging the current knowledge gaps specific to RTNLB5.

What are common challenges in expressing and purifying recombinant RTNLB5 and how can they be overcome?

Membrane proteins like RTNLB5 present several challenges in recombinant expression and purification. Here are common issues and solutions:

  • Expression challenges:

    ChallengeSolution Approaches
    Protein toxicity in expression hostUse tightly controlled inducible promoters; try lower induction temperatures (16-20°C)
    Inclusion body formationUse solubility-enhancing fusion partners (MBP, SUMO, etc.); optimize induction conditions
    Low expression levelsTry different expression hosts; codon-optimize sequence; use strong promoters balanced with optimal induction conditions
    Improper membrane insertionUse specialized E. coli strains (C41/C43); consider eukaryotic expression systems
  • Purification challenges:

    ChallengeSolution Approaches
    Detergent selectionScreen multiple detergent classes; consider newer amphipols or nanodiscs
    Protein aggregationInclude stabilizing additives (glycerol, specific lipids); optimize buffer conditions
    Low purityImplement multi-step purification strategy; consider on-column detergent exchange
    Loss of functionVerify function at each purification step; maintain cold chain; minimize exposure to air
  • Quality control methods:

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

    • Circular dichroism to confirm proper folding

    • Functional assays specific to RTNLBs (membrane tubulation/binding assays)

  • Advanced approaches:

    • Cell-free expression systems

    • Lipid nanodiscs or synthetic bilayers for stabilization

    • Directed evolution to obtain more stable variants

These approaches should be systematically tested and optimized for RTNLB5 specifically.

How can researchers effectively study RTNLB5 localization and dynamics in live cells?

To effectively study RTNLB5 localization and dynamics in live cells, researchers should employ these advanced imaging approaches:

  • Fusion protein design considerations:

    • Test both N- and C-terminal fluorescent protein fusions

    • Use small fluorescent tags to minimize interference with function

    • Verify functionality of fusion proteins through complementation tests

    • Consider photoconvertible or photoswitchable fluorescent proteins for tracking protein movement

  • Advanced imaging techniques:

    • Confocal microscopy for basic localization studies

    • Super-resolution microscopy (STORM, PALM, SIM) for detailed membrane organization

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Fluorescence Correlation Spectroscopy (FCS) for quantifying diffusion rates

    • Single-particle tracking for following individual protein complexes

  • Colocalization studies:

    • Use established organelle markers (particularly ER markers)

    • Employ spectral unmixing for closely overlapping fluorophores

    • Quantify colocalization using appropriate statistical methods

  • Inducible expression systems:

    • Use estradiol-inducible or dexamethasone-inducible systems for temporal control

    • Consider optogenetic approaches for spatiotemporal precision

  • Environmental challenges:

    • Design systems to study localization changes during pathogen challenge

    • Monitor responses to abiotic stresses

These approaches will provide comprehensive information about RTNLB5 behavior in living plant cells under various conditions.

What are the most promising research directions for understanding RTNLB5 function in plant biology?

Based on current knowledge of reticulon proteins and the specific information about RTNLB family members, several promising research directions emerge for RTNLB5:

  • Integrative multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics in rtnlb5 mutants

    • Use systems biology to place RTNLB5 in broader cellular networks

    • Employ CRISPR-based screens to identify genetic interactions

  • Structural biology approaches:

    • Determine high-resolution structure of RTNLB5 using cryo-EM or X-ray crystallography

    • Study membrane topology and insertion mechanisms

    • Investigate structural changes during protein function

  • Role in environmental responses:

    • Investigate RTNLB5 function under various abiotic stresses

    • Examine potential roles in drought, salt, or temperature stress responses

    • Study involvement in cellular stress signaling pathways

  • Developmental biology:

    • Characterize RTNLB5 roles in specific developmental processes

    • Investigate tissue-specific functions using cell-type specific promoters

    • Examine potential roles in cell division and growth

  • Biotechnological applications:

    • Explore potential for enhancing plant resistance to pathogens

    • Investigate applications in membrane protein production systems

    • Consider roles in specialized metabolism and bioengineering

These directions would significantly advance our understanding of RTNLB5 while connecting to broader questions in plant biology.

How might emerging technologies advance our understanding of RTNLB5 function?

Emerging technologies offer powerful new approaches to study RTNLB5 function:

  • CRISPR/Cas technologies:

    • Base editing for introducing specific mutations without double-strand breaks

    • Prime editing for precise nucleotide changes

    • CRISPR activation/interference for manipulating expression levels without genetic modification

    • Multiplexed CRISPR for studying gene interactions

  • Advanced imaging technologies:

    • Cryo-electron tomography for visualizing RTNLB5 in native membrane environments

    • Correlative light and electron microscopy (CLEM) for connecting function to ultrastructure

    • Expansion microscopy for enhanced resolution of subcellular structures

    • Label-free imaging methods for studying native protein dynamics

  • Single-cell approaches:

    • Single-cell transcriptomics to identify cell-specific expression patterns

    • Single-cell proteomics for protein-level analysis

    • Spatial transcriptomics to map expression within tissues

  • Computational approaches:

    • AlphaFold2 and related tools for protein structure prediction

    • Molecular dynamics simulations of RTNLB5 in membranes

    • Machine learning approaches to identify patterns in multi-omics data

  • Synthetic biology tools:

    • Optogenetic control of RTNLB5 activity

    • Engineered protein scaffolds to study membrane organization

    • Minimal synthetic systems to reconstitute RTNLB5 function

These emerging technologies, when applied to RTNLB5 research, will provide unprecedented insights into its molecular function and cellular roles.

What is the current state of knowledge regarding RTNLB5 and what are the critical knowledge gaps?

The current state of knowledge regarding RTNLB5 appears to be limited compared to other RTNLB family members. From the available information, we know that:

  • Established knowledge:

    • RTNLB5 belongs to the reticulon-like protein family in Arabidopsis thaliana

    • T-DNA insertion mutants for RTNLB5 have been generated with insertions mainly in the 3' or 5' UTR regions

    • RTNLB5-7 proteins showed no interactions with RTNLB1-8 proteins in yeast two-hybrid assays

    • As a reticulon protein, RTNLB5 likely contains a reticulon homology domain with two large hydrophobic regions separated by a loop

  • Critical knowledge gaps:

    • Specific biological functions of RTNLB5 remain largely unexplored

    • Phenotypic consequences of RTNLB5 mutation or overexpression are not well characterized

    • Interaction partners specific to RTNLB5 are unknown

    • Subcellular localization and dynamics need confirmation

    • Potential involvement in pathogen responses requires investigation

    • Tissue-specific expression patterns and developmental roles are undetermined

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.