Recombinant Arabidopsis thaliana Reticulon-like protein B6 (RTNLB6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
RTNLB6; At3g61560; F2A19.160; Reticulon-like protein B6; AtRTNLB6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB6
Target Protein Sequence
MAEELEKSMHKEESLMEKIADKIHDHDSSSSSDSEHEKPESPSALKAKIYRLFGREKPVH KVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLS NAHAFMNKTPPKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGL WIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVL SKLPVASLKAKLG
Uniprot No.

Target Background

Gene References Into Functions
  1. RTNLB proteins, in addition to their role in endoplasmic reticulum (ER) shaping, may significantly contribute to the connection between the cortical ER and the plasma membrane. PMID: 26353761
  2. Reticulon (RTNLB) family proteins RTNLB3 and RTNLB6 are recruited to the cell plate during late telophase, coinciding with primary plasmodesmata (PD) formation, and remain associated with primary PD in the mature cell wall. PMID: 26084919
Database Links

KEGG: ath:AT3G61560

STRING: 3702.AT3G61560.2

UniGene: At.34268

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

Where is RTNLB6 localized in plant cells?

RTNLB6 is predominantly localized to the endoplasmic reticulum (ER) in plant cells . Reticulon proteins in general have been found predominantly associated with the endoplasmic reticulum in yeast and mammalian cells, and research suggests that plant reticulon-like proteins follow a similar localization pattern . The protein's hydrophobic domains enable it to integrate into the ER membrane, where it is believed to participate in creating and maintaining the tubular structure of the ER network . Some studies have detected RTNLB proteins from Arabidopsis thaliana in plasma membrane-enriched fractions as well, suggesting potential additional localizations or functions .

How does RTNLB6 differ from other reticulon-like proteins in Arabidopsis?

RTNLB6 is one of 21 reticulon-like proteins identified in the Arabidopsis thaliana genome . Based on sequence homology and structural organization, these proteins can be categorized into three distinct subfamilies . While all reticulon-like proteins share the characteristic reticulon homology domain (RHD), RTNLB6 has unique features that differentiate it from other family members. Mass spectrometry analysis comparing protein interactions between RTNLB3 and RTNLB6 revealed that while they share many interaction partners (approximately 83% overlap), RTNLB6 has 20 unique interacting proteins (representing 17% of its total interactions) . This suggests that despite structural similarities, RTNLB6 may be involved in specific cellular processes distinct from other reticulon-like proteins.

What experimental techniques are commonly used to study RTNLB6?

Several experimental techniques have been employed to study RTNLB6 and other reticulon-like proteins:

  • GFP Immunoprecipitation assays coupled to mass spectrometry: This approach is used to identify proteins that potentially interact with RTNLB6 .

  • Förster resonance energy transfer by fluorescence lifetime imaging microscopy (FRET-FLIM): This technique confirms protein-protein interactions in vivo by measuring the reduction in excited-state lifetime of GFP-labeled proteins when interacting with an acceptor fluorophore (like mRFP) .

  • Subcellular localization studies: Using fluorescent protein fusions (like GFP-RTNLB6) to determine the localization of RTNLB6 within plant cells .

  • Expression systems: Recombinant production of RTNLB6 protein using various expression systems for structural and functional studies .

  • Bioinformatics analysis: In silico approaches to identify conserved domains and predict potential functions based on sequence homology .

What is known about the protein-protein interaction network of RTNLB6?

RTNLB6 engages in a complex network of protein interactions that likely underpin its cellular functions. Mass spectrometry analysis identified 126 proteins that co-immunoprecipitated with RTNLB6, with 20 proteins (17%) being unique to RTNLB6 compared to RTNLB3 . The interaction partners were ranked according to their percentage of total spectra, which indicates the relative abundance of specific proteins bound to RTNLB6 and serves as a reliability measure for each potential interaction .

FRET-FLIM analysis confirmed that RTNLB6 can form both homomeric interactions (RTNLB6-RTNLB6) and heteromeric interactions with other proteins . When studied using FRET-FLIM, RTNLB6-GFP alone showed a fluorescence lifetime of 2.63 ± 0.06 ns, while excited-state lifetimes for RTNLB-RTNLB interactions ranged from 2.31 to 2.38 ns, indicating statistically significant differences that confirm physical interactions .

Table 1: Analysis of RTNLB6 Protein Interactions from Mass Spectrometry

Analysis StepNumber of Proteins
Total proteins identified with RTNLB6621
After removal of wild-type control proteins126
Proteins unique to RTNLB6 (not shared with RTNLB3)20 (17%)
Proteins subjected to FRET-FLIM validation17

How can researchers effectively produce recombinant RTNLB6 for experimental studies?

Production of recombinant RTNLB6 requires careful consideration of expression systems and purification strategies due to its membrane-associated nature. For experimental studies, researchers typically use the following approach:

  • Expression vector selection: The gene encoding RTNLB6 (At3g61560) is cloned into an appropriate expression vector with a tag system to facilitate purification (the tag type may vary depending on experimental needs) .

  • Expression system: While the search results don't specify the particular expression system used for RTNLB6, recombinant membrane proteins are often produced in systems like E. coli, yeast, insect cells, or plant-based expression systems.

  • Purification strategy: Affinity chromatography based on the chosen tag, followed by additional purification steps if needed.

  • Buffer optimization: The recombinant RTNLB6 is typically stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability .

  • Storage conditions: For long-term storage, the purified protein should be kept at -20°C or -80°C. Working aliquots can be stored at 4°C for up to one week, and repeated freezing and thawing should be avoided .

The resulting recombinant protein can then be used for various applications, including structural studies, interaction analyses, and functional assays.

What methodologies are used to investigate RTNLB6's role in ER membrane shaping?

Investigating RTNLB6's role in shaping the ER membrane requires a combination of imaging techniques and functional assays:

  • Advanced microscopy techniques: Researchers use high-resolution microscopy methods to visualize ER morphology in cells expressing normal or altered levels of RTNLB6. These include confocal microscopy, electron microscopy, and super-resolution microscopy to capture detailed images of ER tubule formation and structure .

  • Live-cell imaging: By tagging RTNLB6 with fluorescent proteins like GFP, researchers can observe its dynamics and distribution in living cells, providing insights into how it contributes to ER remodeling in real-time .

  • FRET-FLIM analysis: This technique allows researchers to detect and quantify protein-protein interactions that may be critical for RTNLB6's membrane-shaping functions . FRET-FLIM measures the reduction in the excited-state lifetime of GFP (donor) fluorescence in the presence of an acceptor fluorophore (e.g., mRFP), indicating physical interactions between proteins within a distance of 1 to 10 nm.

  • Genetic approaches: Knockout or knockdown of RTNLB6, as well as overexpression studies, help determine how altering RTNLB6 levels affects ER morphology. These can be complemented with rescue experiments using mutated versions of RTNLB6 to identify critical domains for its function.

  • Biochemical reconstitution: In vitro systems using purified components and artificial membranes can demonstrate RTNLB6's direct effects on membrane curvature and tubulation.

How do RTNLB6 interactions differ between normal development and stress conditions?

While the search results don't directly address RTNLB6's behavior under stress conditions, this represents an important research question based on what we know about reticulon proteins. To investigate this question, researchers would typically employ the following methodologies:

  • Stress induction experiments: Exposing plants or plant cells to various stresses (drought, salt, heat, cold, pathogen infection) followed by analysis of RTNLB6 expression, localization, and interaction patterns.

  • Comparative proteomics: Using immunoprecipitation coupled with mass spectrometry to compare RTNLB6 interaction partners under normal versus stress conditions. This approach can reveal stress-specific interactions that may illuminate RTNLB6's role in stress responses.

  • Transcriptome analysis: RNA-seq or microarray studies comparing expression patterns of RTNLB6 and related genes under various conditions.

  • Phenotypic analysis: Comparing the stress sensitivity of wild-type plants versus those with altered RTNLB6 expression to determine functional relevance.

  • ER stress assays: Since reticulon proteins are associated with the ER, examining how RTNLB6 responds to specific ER stresses (like unfolded protein response) would be particularly relevant.

What is the evolutionary significance of RTNLB6 compared to reticulon proteins in other organisms?

The evolutionary relationship between plant reticulon-like proteins and those in other organisms provides insights into conserved functions and specialized adaptations. To study this aspect of RTNLB6, researchers would employ:

  • Phylogenetic analysis: Constructing evolutionary trees based on sequence comparisons between RTNLB6 and reticulon proteins from various species, including other plants, animals, and fungi.

  • Comparative genomics: Analyzing the genomic context of RTNLB6 and its homologs across species to identify syntenic relationships and gene family expansions or contractions.

  • Structural comparison: Using predictive modeling and available structural data to compare the three-dimensional organization of RTNLB6 with reticulon proteins from other organisms, focusing on conserved domains.

  • Functional complementation: Testing whether RTNLB6 can functionally replace reticulon proteins in other organisms (like yeast or animal cells) to determine functional conservation.

  • Conserved interactome analysis: Comparing the interaction partners of RTNLB6 with those of reticulon proteins in other organisms to identify evolutionarily conserved interaction networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.